KEGG   Vibrio parahaemolyticus BB22OP: VPBB_2618Help
Entry
VPBB_2618         CDS       T02409                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VPBB_2618
  Energy metabolism
   00680 Methane metabolism
    VPBB_2618
Enzymes [BR:vpb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     VPBB_2618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1:2925719..2928352
Genome map
AA seq 877 aa AA seqDB search
MNEKYAALKSNVRMLGHLLGNTIRDAHGEEIFEKVETIRKLSKSAQAGNQADRESLIEEI
KHLPDEQLTPVTRAFNQFLNLTNIAEQYHTISRHCEEHICEPDAINSLFSKLVQNDVSKL
DTAQAVRDLNIELVLTAHPTEITRRTMINKLVKINECLSKLELSDLSSKERKKTERRLEQ
LIAQSWHSDVIRQQRPTPLDEAKWGFAVVENSLWEAVPDFLREMNDRLKSYLGEGLPIDA
RPVHFSSWMGGDRDGNPFVTHSVTREVLLLSRWKAADLYLNDINELISELSMTVSNDQVR
ELAGEDQHEPYRAILKQLRALLNETKDILDAKIHGQKLAVKAPLQKVEQLWDPLYACYQS
LHECGMGVIADGSLLDTLRRVKAFGVHLVRLDIRQESTRHADVLSELTRYLGIGDYEQWS
EQDKIAFLTNELASKRPLLPRDWEPSEPVKEVLDTCKIIALQPREAFGAYVISMARTASD
VLAVHLLLQEAGCPYRMDVCPLFETLDDLNNAESVITQLMSIDLYRGFIQNHQMVMIGYS
DSAKDAGVMSAGWAQYHAMESLVKVAEDEGVELTLFHGRGGTVGRGGAPAHAALLSQPPK
SLKGGLRVTEQGEMIRFKLGLPDVAVNSFNLYASAILEANLLPPPEPKQEWRDLMEVLSE
VSCEAYRGVVRGEPDFVPYFRQATPELELGKLPLGSRPAKRNPNGGVESLRAIPWIFSWS
QNRLVLPAWLGAGEAIQYSVDKGHQALLEEMCREWPFFSTRLGMLEMVYTKCNMEISRYY
DQRLVEPQLQPLGDRLREQLQCDIKSVLNVENNENLMQSDPWGQESIRLRNIYVEPLNML
QAELLYRTRQTEEASANLEEALMVTIAGIAAGMRNTG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaatacgccgcacttaaaagcaatgtgcgcatgttaggccacttactgggt
aacacgattcgcgatgcccacggcgaagaaatcttcgagaaagtggagaccattcgtaaa
ttatccaaatcggctcaagcaggtaatcaagcagacagggaaagcttgatagaagaaatc
aaacacctacccgatgagcaactaacgccagtcacccgtgcgtttaaccaatttctaaac
ctcaccaatattgccgagcaataccacaccatttcacgtcactgtgaagagcacatctgt
gaaccagacgcgatcaactcgctgttttcaaaactggtacaaaacgatgttagcaaactc
gatacggctcaagcggtacgtgatttgaatattgaactggtattaaccgcgcaccccacg
gaaatcactcgccgcaccatgatcaataaactggtcaagatcaatgagtgtttatccaaa
ctagaactcagcgacctgtcttctaaagaacgcaaaaaaacagagcgtcgcttagagcaa
cttatcgcacaaagctggcattctgacgtgattcgtcaacaacgccctactccattggat
gaagcgaaatggggctttgccgtagtagaaaactcactgtgggaagcagtgccagatttc
ctacgtgaaatgaatgatcgtctgaagtcttacctaggtgaaggtttaccaattgatgct
cgtccagtgcatttctcttcttggatggggggtgaccgtgatggcaacccgttcgttact
catagcgtaacgcgtgaagtactgcttctgtctcgttggaaagccgctgacctttatctc
aatgacatcaatgaattgatcagcgaactctctatgaccgtttctaacgatcaagttcgt
gaacttgctggtgaagatcaacacgaaccataccgcgcaatcctgaaacaactacgtgct
ctgctcaatgaaaccaaagatattcttgatgcgaagatccacggtcaaaaactggcagtc
aaagcaccgctacaaaaagttgaacagctttgggatcctctgtacgcgtgttaccaatca
ctgcatgagtgcggcatgggcgtcatcgctgacggctcgttgctagatacgctgcgtcgt
gtgaaagcgtttggcgttcacctagttcgtcttgatatccgccaggaaagtacgcgccac
gcagatgtactctctgagctgactcgatacctcggcattggtgattacgaacagtggagc
gagcaagataaaattgctttcctcaccaatgaacttgcgtctaaacgtccgctactgcca
cgcgattgggaaccatcagagcctgtcaaagaggttttagacacctgtaagatcatcgct
ctgcaaccgcgcgaagcgttcggtgcttacgtcatctcaatggctcgtaccgcctcagac
gtactcgctgtgcacctattactgcaagaagcgggctgcccttaccgtatggatgtttgt
cctctgttcgaaactctagacgacttgaataatgcggaatcggtcattacgcagctaatg
agtatcgacctttaccgtggctttattcaaaaccaccaaatggtcatgatcggctactct
gattcagcaaaagatgcgggtgtcatgtcggcaggctgggctcagtaccatgctatggaa
tctctagttaaagtggcagaagacgaaggtgttgagctgactctgttccatggtcgtggc
ggcaccgttggtcgcggcggcgcacctgcacacgcggctctgctgtctcaaccaccaaag
agcttgaaaggcgggttacgcgtaacagaacaaggcgaaatgatccgctttaaactgggt
ctacctgatgttgcggtaaacagcttcaacttgtatgcaagcgccattttggaagcaaat
ctactgccaccaccagagccaaaacaagaatggcgcgacttgatggaagtgctgtcggaa
gtgagctgtgaagcttaccgtggcgtcgtccgtggcgaaccagattttgttccatacttc
cgtcaagcgacgcctgaactagagctaggcaaactgccgcttggttcacgccctgcgaaa
cgtaatccaaatggcggtgtagaaagcctacgtgcaattccttggatcttctcgtggagc
caaaaccgtttggtgcttccggcttggttaggcgcaggtgaagctattcagtactcagta
gacaaaggtcatcaggcgctactggaagaaatgtgtcgcgaatggccgttcttctcaact
cgcctaggtatgcttgagatggtgtacaccaagtgcaacatggaaatctctcgctactat
gaccaacgcctagttgaaccccaacttcaaccattgggtgaccgactgcgtgaacagctt
caatgtgatattaagtccgtactgaacgtagagaacaacgaaaacctaatgcaaagcgac
ccatggggccaagaatcaattcgcctacgtaacatctacgtagagccattgaacatgctt
caagctgaattgctataccgtactcgtcaaacagaagaggcgtctgcaaaccttgaagag
gcactgatggtgaccatcgcaggtattgcagcaggtatgcgtaacacgggttaa

DBGET integrated database retrieval system