KEGG   Variovorax paradoxus B4: VAPA_1c20780Help
Entry
VAPA_1c20780      CDS       T02835                                 

Definition
(GenBank) putative ribulose bisphosphate carboxylase
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
vpd  Variovorax paradoxus B4
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:vpd00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    VAPA_1c20780
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    VAPA_1c20780
Enzymes [BR:vpd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     VAPA_1c20780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(2200613..2201884)
Genome map
AA seq 423 aa AA seqDB search
MTVTERIRARYLIETPLDPAAVAEVMAGEQSCGTFTRVEGETDALRERARATVDAITELA
PAETPSLPNALLERKGTRGPWRRALVDISFPAANIGANLPTLAATVSGNLYDLGEVTGLR
LESLKLPAAYRTQFEMPRAGIAGTRRTTGVASGALVGTIIKPNVGLSASETAALVARLCA
AGVDFIKDDEVCADPAHAPLAERVPAVMAVVRAHQERTGKHVMVAFNITDETDAMKRHAD
LVEREGGSCVMASLNWCGHSGMQTLRRHTGLALHGHRNGYGALSRHPLLGISFQAYQTLW
RLAGVDHMHVHGLQGKFSQPDSEVIESARDCFTPLTDAADDRVMPAFSSGQWAGTVPATW
AAIGSDDLLFMAGGGILAHPDGAAAGVTSIRQAWSAARAGTALEEAARSAPELARALAFF
GKP
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtgactgaacgcatccgcgcgcgctacttgatcgagacgccgctggacccggcc
gccgtggccgaggtgatggccggcgaacaatcgtgcggcaccttcacgcgcgtcgagggc
gagaccgacgcactgcgcgaacgcgcgcgcgccacggtcgacgcgatcaccgagcttgca
ccggccgagacgccgagcctgcccaacgccctgctcgaacgcaagggcacgcgcggcccg
tggcgccgtgcgctggtcgacatctcgtttccggcagcgaacatcggcgccaacctgccg
acgctcgcggccacggtgtcgggcaacctctacgacctgggcgaagtcacgggcctgcgg
ctcgaatcgctgaaactgccggccgcgtaccgcacgcagttcgagatgccgcgcgccggc
atcgcgggcacgcggcgcactacgggcgtggcgagcggcgcgctggtcggcaccatcatc
aagccaaacgtgggcctgtccgccagcgaaaccgccgcgctggtcgcacggctctgcgcc
gcgggcgtcgacttcatcaaggacgacgaggtctgcgccgatcccgcgcatgcgccgctc
gccgagcgcgtgcccgcggtgatggccgtggtgcgcgcccaccaggagcgcaccggcaag
cacgtgatggtggccttcaacatcaccgacgaaaccgatgcgatgaagcggcacgccgac
ctggtcgagcgcgaaggcggatcgtgcgtcatggccagcctcaactggtgcggccattcg
ggcatgcagaccctgcgccgccacaccggcctggcgctgcacggccaccgcaacggctac
ggcgcgctgtcgcgccatccgctgctgggcatttcgttccaggcctatcagacgctctgg
cggctggccggggtcgaccacatgcacgtgcatggcctgcagggcaagttctcgcagccc
gacagcgaagtcatcgaatcggcgcgcgactgcttcacgccgctgaccgatgctgccgac
gaccgcgtgatgccggccttctcgtcgggccagtgggccggcacggtgccggccacctgg
gccgccatcggcagcgacgacctgctcttcatggccggcggcggcatcctcgcgcatccc
gatggcgcggcggccggcgtcaccagcatccgccaggcctggtcggctgcgcgcgccggc
accgcgctggaagaagccgcccgcagcgcgcccgaactggcgcgcgcgctggccttcttc
ggcaagccgtga

DBGET integrated database retrieval system