KEGG   Variovorax paradoxus B4: VAPA_2c08070Help
Entry
VAPA_2c08070      CDS       T02835                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  
alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
vpd  Variovorax paradoxus B4
Pathway
Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:vpd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VAPA_2c08070
Enzymes [BR:vpd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     VAPA_2c08070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:826776..828236
Genome map
AA seq 486 aa AA seqDB search
MTLAPAPLFQNHVDGAWVSSVTGRTFESTNPADAREVVGRFQASSAEDARAAVAAAAAAF
DGWKKTPISRRAAMLNAAALYLEMHAATFAEELTREEGKPLAQAKDEFLRSAQTLRFYAV
EGQSFSGETFPQDDPDMVVYSQREPLGVVTVISPWNFPVSIPARKIAPALITGNTVVFKP
SSDAPLSGLRLAEAFVQAGLPKGVLNFITGRASEVGPAITESPAVRAISFTGSTAAGEQI
HRAAAMTTRTQMELGGKNPLIVMDDADLDKAVDLAVKGGLSLSGQACTGTSRVLVMKGAK
AAFTDKLVAKVRALRIGSGMAPGMDMGPLATRKQLETVLAYIAIGKSEATLLCGGEPLTE
GDLAHGFYVSPAIFTDVTQQMRIAREEIFGPVIALIEVDSYEDAIAKANDTEYGLSAAIA
TSSPVHAHRFAHDIQSGTVKINRTTTGNLVNAPFGGLKRSSTSTFRESGRTGLEFYTQIK
TVYRGC
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcgcacccgctccccttttccagaaccacgtcgatggcgcctgggtgtccagc
gtgaccggccgcaccttcgagagcacgaacccggccgatgcccgcgaggtggtcggccgc
ttccaggcctcgtccgccgaggacgcccgggcggccgtcgccgccgcggcagccgcgttc
gacggctggaagaagacacccatctccaggcgggccgcgatgctcaacgccgcggcgctg
tacctggagatgcacgcggcgacattcgcggaggaactgacgcgcgaagagggcaagccc
ctcgcgcaggccaaggacgagttcctgcggtcggcccagacgctgcgcttctatgcggtg
gagggccagtccttctccggcgagaccttcccgcaggacgatccggacatggtggtctac
agccagcgcgagccgctgggcgtggtcacggtcatcagcccctggaacttcccggtgtcg
atccccgcgcgcaagatcgcgccggcgctgatcacgggcaacacggtggtcttcaagcct
tcgtccgacgcgccgctgtcgggcctgcgcctggccgaggccttcgtgcaggccggcctg
cccaagggggtgctgaacttcatcaccgggcgcgcgtcggaagtcggccccgcgatcacc
gaatctccggccgtgcgcgccatctccttcaccggctcgaccgcggccggcgagcagatc
caccgcgccgccgccatgaccacgcgcacgcagatggagctcggcggcaagaacccgctg
atcgtgatggacgacgccgacctcgacaaggcggtcgacctcgccgtcaagggcggcctc
tcgctcagcggccaggcctgcaccggcaccagccgcgtgctggtgatgaagggcgcgaag
gccgccttcaccgacaagctggtggccaaggtgcgcgcgctcaggatcggcagcggcatg
gcgccgggcatggacatgggcccgctcgcgacgaggaagcagctggagacggtgctggcc
tacatcgccatcggcaagtccgaagccacgctgctgtgcggcggcgagccgctcaccgag
ggcgaccttgcccacggcttctatgtgagcccggccatcttcaccgacgtgacgcagcag
atgcgcatcgcgcgcgaggagatcttcggcccggtgatcgcgctcatcgaggtcgacagc
tacgaagacgcgatcgccaaggccaacgacaccgaatacggcctgtccgccgccatcgcg
acgagcagcccggtgcatgcgcaccgcttcgcgcacgacatccagtcgggcacggtgaag
atcaaccgcaccaccaccggcaacctcgtcaacgcgcccttcggcggcctcaagcgctcc
agcacctcgaccttccgcgagtcgggccgcaccggcctggagttctacacgcagatcaag
accgtctaccgcggctgctga

DBGET integrated database retrieval system