KEGG   Variovorax paradoxus EPS: Varpa_0233Help
Entry
Varpa_0233        CDS       T01392                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
vpe  Variovorax paradoxus EPS
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Varpa_0233
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Varpa_0233
Enzymes [BR:vpe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Varpa_0233
Peptidoglycan biosynthesis and degradation proteins [BR:vpe01011]
 Precursor biosynthesis
  Racemase
   Varpa_0233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
250169..251269
Genome map
AA seq 366 aa AA seqDB search
MPRPILATVHTAALRNNLERVRRSALDARVWAVVKANAYGHGIERVYEGLRGADGFALLD
LAEAERVRALGWRGPVLLLEGVFDARDLELCSRLDLWHTVHCDEQIDMLAAHKTLKPQRV
FLKMNSGMNRLGFTPERFGSAWTRLNALTQVDEISLMTHFSDADGARGIAHQLEAFERAT
RDLPGERSIANSAATLRHADQTRGDWVRPGIVLYGSAPDFPLHDAAHWQLQPTMTLSTQL
LSVQTLKAGDTIGYGSNFTAEGPLTIGVAAVGYADGYPRHCNTGTPVLVNGVRTRMVGRV
SMDMITVDLTPVPDAKFGAEVTLWGRSASTGAVLPIDEVAQAAGTVGYELMCAVAQRVPF
AAPTDE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgccccattcttgccaccgtccacaccgccgcccttcgcaacaacctggagcgg
gtccgccgttcggcgctcgacgcccgtgtctgggccgtggtcaaggccaatgcctatggc
cacggcatcgagcgggtctatgaaggcctgcgcggcgccgacggcttcgcgctgctcgac
ctggccgaggccgagcgcgtgcgcgccctgggctggcgcggccccgtgctgctgctggaa
ggcgtgttcgatgcgcgcgacctggagctgtgctcgcgcctggacctctggcacaccgtg
cattgcgacgagcagatcgacatgctcgcagcgcacaagaccctcaagccgcagcgtgtt
ttcctgaagatgaactcgggcatgaaccgcctgggcttcacgcccgagcgcttcggctcg
gcctggacgcgcctgaacgcgctcacgcaggtcgacgagatctcgctgatgacgcacttc
agcgacgccgacggcgcccgcggcatcgcgcaccagctcgaagccttcgagcgcgccacg
cgcgacctgccgggcgagcgctccattgccaacagcgccgccaccctgcgtcacgccgac
cagacgcgcggcgactgggtgcgccccggcatcgtgctgtacggcagcgcccccgacttt
ccgttgcacgacgcggcgcactggcaactgcagcccacgatgacgctgtcgacgcaactg
ctctcggtgcagacgctcaaggccggcgacaccatcggctatggctccaacttcacggcc
gaggggccgctcaccatcggcgtggccgcggttggctacgccgatggctatccgcgccac
tgcaacaccggcacgccggtgctggtgaacggcgtgcgcacccgcatggtgggccgcgtg
agcatggacatgatcaccgtcgacctcacgccggtgcccgatgcgaagttcggcgccgaa
gtcacgctgtggggccgctccgcttcgacgggcgcggtgctccccatcgacgaagtcgcg
caggccgcgggcaccgtcggctacgaactcatgtgcgccgtggcccagcgcgtgccgttc
gccgctcccaccgacgaatga

DBGET integrated database retrieval system