KEGG   Virgibacillus pantothenticus: A21D_02853Help
Entry
A21D_02853        CDS       T05261                                 

Gene name
yojM_2
Definition
(GenBank) Superoxide dismutase-like protein YojM precursor
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vpn  Virgibacillus pantothenticus
Brite
Enzymes [BR:vpn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A21D_02853 (yojM_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AUJ25898
UniProt: A0A2K9J1R8
LinkDB All DBs
Position
3084467..3085036
Genome map
AA seq 189 aa AA seqDB search
MRMVMVISLLLIAVACQPKDEKTKEVEMYNSSGDMVGTASFHEQSDGVKVKVELEGLEPG
FHGIHVHEYAKCEAPDFTSAGNHFNPTGAEHGLMHPEGNHLGDMPNIEADANGVINAELM
MPETTLLDGKNSLIKGEGTSVIVTKNKDDGVSQPGGDSGERIICGTLTKTNGDNEKQPSD
PTQNNEDEK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgagaatggtgatggtcatttctctattattaatagctgtagcttgccagccaaaagat
gaaaaaacaaaagaagttgaaatgtacaattcatcaggtgatatggttggtacagccagt
tttcatgaacaatctgatggggtaaaggtgaaagtggaattagaagggctggaaccaggg
tttcatggaatacatgtacacgaatacgccaaatgtgaagcacctgatttcacatcagct
ggcaatcattttaacccgactggtgcagaacatggtctcatgcatccagaaggaaaccat
ttaggggacatgccgaacatagaagcggatgctaacggagttattaacgctgaactaatg
atgccagagacgacgttattagatggaaaaaattcgctaattaagggtgaaggaacatcc
gttattgttactaaaaataaagatgacggagtaagccaacctggtggagattcaggagag
agaataatttgtggcacgttaacaaaaacaaatggtgataatgaaaaacaaccatcagac
ccaacacaaaataatgaagatgaaaagtag

DBGET integrated database retrieval system