KEGG   Aliivibrio salmonicida: VSAL_I1197Help
Entry
VSAL_I1197        CDS       T00782                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase beta
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
vsa  Aliivibrio salmonicida
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:vsa00001]
   00650 Butanoate metabolism
    VSAL_I1197 (gadB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VSAL_I1197 (gadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VSAL_I1197 (gadB)
   00430 Taurine and hypotaurine metabolism
    VSAL_I1197 (gadB)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    VSAL_I1197 (gadB)
Enzymes [BR:vsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VSAL_I1197 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:1304769..1306163
Genome map
AA seq 464 aa AA seqDB search
MPLHSKDTVRDDLLDDVYSSTDLSLSMPKYKMPEHEHDPRHAYQVVHDELMMDGNSRQNL
ATFCQTWVEDEVHKLMDECIDKNMIDKDEYPQTAELEARCVHMLADLWNSPDAENTLGCS
TTGSSEAAMLGGMALKWAWREKMKKLGKPTDKPNMICGPVQVCWHKFARYWDIELREIPM
EGDRLIMTPEEVIKRCDENTIGVVPTLGVTFTCQYEPVKAVHEALDKLQEETGLDIPMHI
DAASGGFLAPFCDPELEWDFRLPRVKSINASGHKFGLSPLGVGWVIWRDASALHEDLIFN
VNYLGGNMPTFALNFSRPGGQIVAQYYNFLRLGKEGYRKIHQACYDTAVYLSAEIEKMGM
FDIIYDGKGGIPAMSWSLKEGVNPGFNLFDLSDRIRSRGWQIAAYAMPPKREDLVIMRIL
VRHGFSRDQADLLVADLKHCIEFFDKHPISHGSDEVESSGFNHG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcctcttcattctaaagatacagtcagagacgatcttcttgatgatgtttattcatca
actgacctttccctatctatgccaaaatacaaaatgcctgagcacgaacatgatcctcgt
catgcttatcaagttgttcatgatgagctaatgatggatgggaattctcgacagaattta
gcgaccttttgccaaacttgggttgaagatgaagtccacaaactaatggacgaatgcatc
gataaaaacatgatcgataaggatgaatatcctcaaaccgcagagcttgaagctcgttgt
gtgcatatgttagctgatttatggaactctccagatgcagaaaatacgttaggttgttct
actacggggtcaagtgaagccgcaatgctcggcggaatggcgctaaaatgggcttggcgt
gaaaaaatgaaaaaacttggcaaaccaacagacaaaccaaatatgatctgtggtcctgtt
caagtgtgctggcataaatttgctcgttattgggatattgaattacgtgagatcccaatg
gaaggcgatcgtctaattatgacgcctgaagaagtgattaaacgttgtgatgaaaatacc
atcggtgtagttccaacgttgggtgtgacatttacttgtcagtatgaaccagtaaaagca
gtgcatgaagcgttagataaactacaagaagaaactggtttagatattccaatgcacatt
gatgcggcgagtggcggtttcttagccccattctgtgatcctgagttagagtgggatttc
cgtttacctcgtgtgaaatcaatcaatgcgtcaggccataaatttggtttgagtccatta
ggtgtgggttgggtaatatggcgtgatgcatctgcattgcacgaagatcttatttttaac
gtgaattacttaggtggcaacatgcctactttcgcgttgaacttctctcgccctggcggc
caaattgtagcgcaatactataatttcttacgtttaggtaaagaagggtaccgtaagatc
caccaagcgtgttacgacacggcggtgtatctttctgctgaaatcgaaaaaatgggcatg
tttgacattatttatgatggtaaaggtggtatccctgcaatgagttggtcgcttaaagaa
ggcgtgaaccctgggtttaacttgtttgatctttcagaccgaattcgttctcgcggttgg
caaattgccgcttatgcaatgccaccaaaacgtgaagacttggtgattatgcgtattttg
gttcgtcatggctttagccgagatcaagctgatctactggttgccgatctgaaacattgc
atcgagtttttcgataagcacccaatctcccatggtagtgatgaagttgaatcttcaggc
tttaatcacggttaa

DBGET integrated database retrieval system