KEGG   Vitis vinifera (wine grape): 100256536Help
Entry
100256536         CDS       T01084                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    100256536
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100256536
Enzymes [BR:vvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     100256536
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
11
AA seq 169 aa AA seqDB search
MAAGILSGPVTSFGYVGLKPHQPKLFPAKDSVAWSRKTVSNGSKTHCMKTWNPINNKKFE
TLSYLPPLSDDSIAKEIDYMLKKGWIPCLEFDEVGYVFRKNSQIPGYYDGRYWTLWKLPM
FGCNDASQVLNEIHECKKTYPNAYIRCLAFDNEHQGQCMAFVIQKPTCS
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggcagctggaatcctctcaggtccggtcacaagtttcggctatgttgggttgaagccc
caccagcccaagctgtttccggcaaaggattcggttgcatggagccggaaaactgtgtca
aatggttctaaaactcattgcatgaagacatggaatccaatcaataacaagaagtttgag
acgctctcttatcttcctcctctctctgatgactcgattgcaaaggagatagactacatg
ctcaaaaagggttggatcccttgccttgaatttgacgaagtgggatatgtatttaggaag
aacagccagattccaggctactacgacgggaggtattggacattgtggaagctgccaatg
ttcgggtgcaatgatgcctctcaagtcctgaatgagattcatgagtgcaagaaaacgtac
ccaaatgcttatatccgctgcttggcatttgacaatgagcaccagggtcagtgcatggcc
tttgtcattcaaaaacccacctgcagctaa

DBGET integrated database retrieval system