KEGG   Vitis vinifera (wine grape): 100262452Help
Entry
100262452         CDS       T01084                                 

Definition
(RefSeq) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00240  Pyrimidine metabolism
vvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100262452
Enzymes [BR:vvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     100262452
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 AAA_24 cobW MobB AAA_22 AAA_30
Motif
Other DBs
NCBI-GeneID: 100262452
NCBI-ProteinID: XP_002266298
LinkDB All DBs
Position
Un
AA seq 283 aa AA seqDB search
MLRMKSLLSPSFSTLSPHLTKTTSFSLYFLASKSILCNSQILKNPDCLHIKSTISSMKPL
MSSNSIQSRRFQIEASQSSSGEIHVIVGPMFSGKTTTLLRRIQSETSNGRKVAIIKSNKD
TRYGLDSIVTHDGVKLPCWALADLSSFREKLGSDAYDELDVIGIDEAQFFGDLYEFCCKA
ADHDGKTVIVAGLDGDYLRRSFGSVLDIIPLADSVTKLTARCEICGKRAFFTLRKTAEKK
TELIGGADVYMPVCRQHYVSGQVVIEEATRIVLESQKVQCGEK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgttaagaatgaaatcgcttctttctccaagtttctcaaccctctctccacatctcacc
aaaaccacttctttctctctgtattttctggcttcaaaatccattctctgcaactcccaa
attctcaaaaaccctgactgtctccacataaaatccacaatatcttccatgaaaccctta
atgtcttcaaactccattcaaagccgtaggtttcagattgaggcgtcccagtcttcttcc
ggagaaattcacgtgattgtcgggcccatgttttccggcaagaccaccactctccttcgg
cgaatccaatccgaaaccagtaatggcagaaaggtagcaataataaaatcaaacaaggac
acaagatatggattggattccattgtgactcatgatggagtgaagttgccatgttgggca
ttggcagatttgtcatctttcagggaaaagcttggttccgatgcttatgatgagcttgat
gtgattggtattgatgaagctcaattctttggcgacctctatgaattttgctgtaaagct
gctgatcatgatggcaaaactgttatagttgctggcctggatggcgactatttgagaagg
agctttggttctgtgctcgatattattccccttgctgattctgttactaagctaactgca
cgatgtgagatttgtgggaaacgggctttctttaccctaaggaagacagcggagaaaaag
acagaactgattggcggggctgatgtgtacatgcctgtgtgtcgacaacattatgtcagt
ggacaagtggtcatagaagaagctacaagaattgtccttgaatctcagaaggtccagtgt
ggcgaaaaatag

DBGET integrated database retrieval system