KEGG   Vibrio vulnificus 93U204: VV93_v1c34180Help
Entry
VV93_v1c34180     CDS       T03294                                 

Definition
(GenBank) glycosidase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
vvl  Vibrio vulnificus 93U204
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VV93_v1c34180
Enzymes [BR:vvl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     VV93_v1c34180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
II:489542..490921
Genome map
AA seq 459 aa AA seqDB search
MTKGDVKKMNQAEHALPTSKANVILHAFDWKYADIAKQAQKIQELGYGSVLVSPPLRSAK
SPKWWQRYQPQDYRVIDNALGNTTDFQNMVTELQRCGVWVYADVVFNHMANEAKQRADLN
YPSKTVLEEYMCDPEYYESQRLFGDLSEPLFTEEDFVEAFGIQDWKDKWQVQNGRISGGP
TDPGLPTLRVHEHVITQQRHYLMALKAMGVKGFRIDAAKHMTLEHIKQVWTEDITQGMHI
FGEIITDGGATEEEYELFLQPYLQETRLGAYDFPLFSTLFKAFAAKGSFKSLIDPYCFGQ
ALSNRRAITFVTTHDIPNNDVFANLVLEEENEWLAYAYVLGRDGGTPLIYTDLDTSGILN
QNGQPRWKDAWHDPRMVQMIAFHNRFHGEPMTVLEGNDDMLVFSRGDRGFVVINKSARKQ
TISLPLARPLQDMLTGKHFLPMNGKIDIVVAAKTALMMC
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaggtgatgtgaagaaaatgaatcaagcagaacacgctttgccgaccagcaaa
gccaacgtaattttgcatgcatttgattggaaatatgccgatatcgctaaacaggcacaa
aaaattcaagagctaggttatggctcagtgcttgtttcaccgccgttacgcagcgccaaa
tcacccaagtggtggcagcgttaccagccacaagattaccgcgtgattgataacgcactt
ggtaacaccactgattttcagaacatggtgaccgagcttcagcgttgtggtgtttgggtc
tatgcggatgtggtgtttaatcatatggcgaatgaagcaaaacagagagcggacttaaac
tacccaagcaaaaccgtgctcgaagagtacatgtgcgatcctgagtattatgaaagccag
cgattgtttggtgatctctctgagcctctatttaccgaagaagattttgttgaagcgttc
ggcattcaagattggaaagacaagtggcaagtgcaaaatggccgtatcagcggcggcccg
accgatcccggtttaccgaccttacgtgttcatgagcatgtgatcacccagcagcgtcat
tatttaatggcgctgaaggcgatgggtgtcaaagggtttcgcattgatgcagcaaagcac
atgacgctcgagcatatcaagcaagtgtggacagaagacattacgcagggcatgcatatc
ttcggtgaaatcattaccgatgggggagccacggaagaggagtatgaactctttctgcaa
ccttacttacaagagactcgtctcggtgcgtacgatttccctctttttagcaccttattt
aaagcctttgccgcgaaaggcagctttaaaagcttgatagacccttactgttttggtcag
gcgttgtcgaatcggcgtgcaattacgtttgtcaccacacatgacattcccaacaatgat
gtgtttgccaacttagtgttggaggaagagaacgagtggctagcttacgcctatgtattg
gggcgtgatggtggaacacctctgatttacaccgatctcgatacgagcggcatacttaac
cagaatgggcagccacgttggaaagacgcttggcatgatccgcgaatggtacagatgatt
gcattccacaaccgctttcatggcgagccaatgacggtgctggaggggaatgatgatatg
ttggtgttcagccgtggtgatcgtggttttgtggtgatcaacaaatcggcgcggaaacaa
acgatctccttaccattagcgcgtcctcttcaagatatgttgacgggcaagcatttctta
ccaatgaacggcaagattgatattgtcgtcgcggcaaaaacggcattgatgatgtgttga

DBGET integrated database retrieval system