Vulpes vulpes (red fox): 112924789 Help Entry 112924789         CDS       T05911                                  Symbol PFN1 Name (RefSeq) LOW QUALITY PROTEIN: profilin-1   KO K05759   profilin Organism vvp  Vulpes vulpes (red fox) Pathway vvp04015   Rap1 signaling pathway vvp04810   Regulation of actin cytoskeleton vvp05014   Amyotrophic lateral sclerosis vvp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:vvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     112924789 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112924789 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112924789 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     112924789 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vvp04131]     112924789 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:vvp04812]     112924789 (PFN1)    04147 Exosome [BR:vvp04147]     112924789 (PFN1) Membrane trafficking [BR:vvp04131]  Others   Actin-binding proteins    Others     112924789 (PFN1) Cytoskeleton proteins [BR:vvp04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      112924789 (PFN1) Exosome [BR:vvp04147]  Exosomal proteins   Proteins found in most exosomes    112924789 (PFN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  112924789 NCBI-ProteinID:  XP_025861055 UniProt:  A0A3Q7U0A2 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAGVGVLIGKDRSSFF VNGLTLGGQKCSVIRDSPLQDGEFTMDLRTESXGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggctggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctataaggactcgccctccgtgtgggccgccgtccccgggaagaccttc gtcaacatcacgccagctggggtcggtgtcctgattggcaaagaccggtcgagttttttc gtgaacgggctgacactgggaggccagaagtgttctgtgatccgggactcgccgctgcag gatggggagtttactatggaccttcggaccgagagcnnaggtggagcgcccactttcaac atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtatgatcaacaagaaatgttatgaaatggcttcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system