KEGG   Vibrio vulnificus CMCP6: VV1_3174Help
Entry
VV1_3174          CDS       T00108                                 

Definition
(GenBank) Aspartate/tyrosine/aromatic aminotransferase
  KO
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VV1_3174
   00290 Valine, leucine and isoleucine biosynthesis
    VV1_3174
   00220 Arginine biosynthesis
    VV1_3174
Enzymes [BR:vvu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     VV1_3174
    2.6.1.66  valine---pyruvate transaminase
     VV1_3174
Amino acid related enzymes [BR:vvu01007]
 Aminotransferase (transaminase)
  Class I
   VV1_3174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
I:3248818..3250032
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSSKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQHYQRKGIRSLDVEDVYVGNGVSELIVMAMQALLNNGD
EMLVPAPDYPLWTAAVALSGGKAVHYLCDEQADWYPDLDDMRKKITPKTRGIVLINPNNP
TGAVYSRDFLLEVIEIARQHKLMIFADEIYDKVLYDGAVHTSVATLTDDVLVMTFNGLSK
AYRVCGFRGGWMFMTGPKHLAQGYVNGLDMLASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRDRAWELINQIPGVSCVKPKGAMYLFPKIDTKKYSIKDDQKMVFDFLVQEK
VLLVQGSGFNWPKPDHFRIVTLPHIEDLETAIGRFERFLHGYSQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatcgggatgtcgtcaaaactcgacaatgtctgctatgacatcaggggtcct
gtactcaaacatgctaagcgcatggaagaagaagggcataaaatccttaagctaaatatt
ggaaaccccgccccatttggctttgacgcccctgatgaaattctggtcgatgtgattcgt
aacttgcctacgtcgcaaggttactgcgattcaaaaggcatctactcagcacgtaaagcc
gtggtacagcactaccaacgcaaaggcattcgttctctcgatgtggaagatgtctacgtg
ggcaatggcgtctctgagctgatcgtgatggccatgcaagcactgcttaacaacggtgac
gaaatgctggttccagcaccagactacccattatggaccgctgccgtggcactttcgggt
ggtaaagcggtgcattacctctgtgatgagcaagcagactggtaccctgatctggatgat
atgcgcaaaaaaatcacgcctaagactcgtggtattgtactcatcaacccaaataaccca
acgggtgccgtctacagccgcgattttctactggaagtgatcgaaatcgcgcgtcaacac
aagctgatgattttcgccgatgaaatctacgacaaggtgttgtacgacggagcggttcac
acctcagtcgcgaccttaactgacgatgtgctggtgatgacgtttaacggcctatcaaaa
gcctatcgcgtatgtggtttccgtggtggttggatgtttatgaccggaccaaaacattta
gcgcaaggctatgttaacggtttggacatgctggcttcgatgcgcctgtgcgccaacgtg
ccaatgcaacacgcgattcaaactgccttggggggctatcagagcatcaatgaattgatc
ttacctggcggtcgtttattggagcaacgtgatcgcgcatgggagttgatcaaccaaatc
cctggcgtttcatgtgtgaaaccaaaaggcgcaatgtatctgttccctaagattgatacg
aaaaaatacagcatcaaagatgaccaaaagatggtttttgattttctcgttcaagaaaaa
gtgttgttagtgcagggttctggattcaactggccaaaaccagaccacttccgcattgtc
actctaccgcatatcgaagatctcgaaaccgccattggccgctttgaacgtttcttacat
ggctatagccagtag

DBGET integrated database retrieval system