KEGG   Vibrio vulnificus CMCP6: VV2_1622Help
Entry
VV2_1622          CDS       T00108                                 

Definition
(GenBank) Glycosidase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VV2_1622
Enzymes [BR:vvu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     VV2_1622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
II:1772306..1773685
Genome map
AA seq 459 aa AA seqDB search
MTKGDVKKMNQAEHALPTSKANVILHAFDWKYADIAKQAQKIQELGYGSVLVSPPLRSAK
SPKWWQRYQPQDYRVIDNALGNTTDFQNMVTELQRCGVWVYADVVFNHMANEAKQRADLN
YPSKTVLEEYMCDPEYYESQRLFGDLSEPLFTEEDFVEAFGIQDWKDKWQVQNGRISGGP
TDPGLPTLRVHEHVITQQRHYLMALKAMGVKGFRIDAAKHMTLEHIKQVWTEDITQGMHI
FGEIITDGGATEEEYELFLQPYLQETRLGAYDFPLFSTLFKAFAAKGSFKSLIDPYCFGQ
ALSNRRAITFVTTHDIPNNDVFANLVLDEENEWLAYAYVLGRDGGTPLIYTDLDTSGILN
QNGQPRWKDAWHDPRMVQMIAFHNRFHGEPMTVLEGNDDMLVFSRGERGFVVINKSARKQ
TVSLPLARPLQDMLTGKHFLPMNGKIDIVVAAKTALMMC
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaggtgacgtgaagaaaatgaatcaagcagaacacgctttgccgaccagcaaa
gccaatgtaattttgcatgcatttgattggaaatatgccgatatcgctaaacaggcacaa
aaaattcaagagctgggttatggctcagtgcttgtttcaccgccgttacgcagcgccaaa
tcacccaagtggtggcagcgttaccagccacaagattaccgcgtgattgataacgcactt
ggtaacaccactgattttcagaacatggtgaccgagcttcagcgttgtggtgtttgggtc
tatgcggatgtggtgtttaatcatatggcgaatgaagcaaaacagagagcggacttaaac
tacccaagcaaaaccgtgctcgaagagtacatgtgcgatcctgagtattatgaaagccaa
cgattgtttggtgatctctctgagcctctatttaccgaagaagattttgttgaagcgttt
ggcattcaagattggaaagacaagtggcaagtgcaaaatggccgtatcagcggtggcccg
actgaccccggtttaccgaccttacgtgttcatgagcatgtgattacccagcagcgtcat
tacttaatggcgctgaaggcgatgggtgtcaaagggtttcgcattgatgcagcaaagcac
atgacgctagagcatatcaagcaagtgtggacagaagacattacgcagggcatgcatatc
ttcggtgaaatcattaccgatgggggagccacggaagaggagtatgaactctttctgcaa
ccttatttgcaagagactcgtctcggtgcgtacgatttccctctttttagcaccttattt
aaagcctttgccgcgaaaggcagctttaaaagcttgatagacccttactgttttggtcag
gcgttgtcgaatcggcgcgcaattacgtttgtcaccacacatgacattcccaacaatgat
gtgtttgctaacttagtgttagatgaagaaaacgagtggttagcttacgcctatgtattg
gggcgtgatggtggaacacctctgatttacaccgatctcgatacgagcggcatacttaac
cagaacgggcagccacgttggaaagacgcttggcatgatccgcgaatggtacagatgatt
gcattccacaaccgctttcatggcgagccaatgacggtgctggaagggaatgatgatatg
ttggtgttcagccgtggtgagcgtggttttgtggtgatcaacaaatcggcgcggaaacaa
acggtctctttaccattagctcgtcctcttcaagatatgttgacgggcaagcatttctta
ccaatgaacggcaagattgacattgtcgttgcggcaaaaacggcgttgatgatgtgttga

DBGET integrated database retrieval system