KEGG   Vibrio vulnificus YJ016: VV3166Help
Entry
VV3166            CDS       T00150                                 

Definition
(GenBank) GTPase - translation elongation factor
  KO
K02358  
elongation factor Tu
Organism
vvy  Vibrio vulnificus YJ016
Brite
Translation factors [BR:vvy03012]
 Eukaryotic Type
  Elongation factors
   VV3166
 Prokaryotic Type
   VV3166
Mitochondrial biogenesis [BR:vvy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    VV3166
Exosome [BR:vvy04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   VV3166
  Exosomal proteins of breast cancer cells
   VV3166
  Exosomal proteins of colorectal cancer cells
   VV3166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:complement(3249881..3251110)
Genome map
AA seq 409 aa AA seqDB search
MVNSGHLNPYLEGQLMSKEKFERVKPHVNVGTIGHVDHGKTTLTAAICTTLAKVYGGAAR
DFASIDNAPEERERGITISTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGGILV
VAATDGPMPQTREHILLGRQVGIPYIIVFMNKCDMVDDEELLELVEMEVRELLSEYDFPG
DDLPVIQGSALGALNGEEQWEAKIIELAEALDTYIPEPERAIDLPFLMPIEDVFSIQGRG
TVVTGRIERGILKVGDEVAIVGIKDTTTTTCTGVEMFRKLLDEGRAGENVGALLRGTKRD
EVERGQVLAKPGSITPHTKFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGDISLP
EGVEMVMPGDNIQMVVELISPIAMDEGLRFAIREGGRTVGAGVVAKIFE
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaattcgggccacctaaatccgtacctagagggacaactcatgtctaaagaaaaa
tttgaacgtgtaaaaccgcacgtaaacgttggtactatcggccacgttgaccacggtaaa
acaactctaactgcagctatctgtactactcttgcaaaagtttacggcggtgctgctcgt
gacttcgcatcaatcgacaacgctccagaagagcgtgagcgtggtatcacaatctctact
tctcacgtagagtacgacactccagctcgccactacgcacacgtagactgtcctggacac
gctgactatgttaaaaacatgatcactggtgctgcacagatggacggtggtatcctagtt
gttgctgcgacagatggcccaatgccacaaactcgtgagcacatcctactaggccgtcag
gttggtatcccttacatcatcgtattcatgaacaaatgtgacatggttgatgatgaagag
cttctagagctagtagaaatggaagttcgtgaacttctatctgagtacgacttcccaggt
gatgacctaccagttatccaaggttctgcactaggcgcactaaacggcgaagagcagtgg
gaagcgaaaatcatcgaactagctgaagctctagatacttacatcccagagccagagcgt
gcaatcgatctaccattcctaatgccaatcgaagacgtattctcaatccaaggtcgtggt
acagtagtaactggccgtatcgagcgtggtattctgaaagttggtgatgaagtagcaatc
gtaggtatcaaagatactacaactactacatgtactggtgttgagatgttccgtaagctt
ctagacgaaggtcgtgcgggtgagaacgttggtgccctactacgtggtactaagcgtgat
gaagtagaacgtggccaagtactagctaagccaggttcaatcactccacacactaagttc
gaatcagaagtatacgtactttctaaagatgaaggtggtcgtcacactccattcttcaaa
ggctaccgtccacagttctacttccgtacaactgacgtaactggtgatatctctctacca
gaaggcgtagaaatggtaatgcctggtgacaacatccaaatggttgttgagctaatctct
ccaatcgcgatggacgaaggtctacgtttcgcgatccgtgaaggtggccgtactgttggt
gctggtgttgttgctaaaatctttgaataa

DBGET integrated database retrieval system