KEGG   Wenyingzhuangia fucanilytica: AXE80_02635Help
Entry
AXE80_02635       CDS       T04444                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
wfu  Wenyingzhuangia fucanilytica
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:wfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXE80_02635
   00020 Citrate cycle (TCA cycle)
    AXE80_02635
   00620 Pyruvate metabolism
    AXE80_02635
Enzymes [BR:wfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AXE80_02635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(599055..600698)
Genome map
AA seq 547 aa AA seqDB search
MATIINMPRLSDTMTEGTVAQWLKKVGDKIEEGDILAEIETDKATMEFESFNEGVLLHIG
LEDGETAPVDSLLAIIGEEGEDISGLLGGGSAEPAAEAPKTEEAAPVAEEAPASEEVAIP
EGVIVVTMPRLSDTMTDGTVASWLKKVGDKVEEGDILAEIETDKATMEFESFNEGTLLYV
GLEEGETAPVDSLLAIIGEAGTDVSAVAANFGKASAPAPKAAPAAEAPKAAAAPAPAKTE
APKASAPTATKKVSAINSENGRIVASPLAKALAEEKGINLAKVVGTGEGGRIVKVDIENY
TPATEAAAPAAKAVAAAPAGEISQREEKNSNMRKAIARALDKSQTENVNFTISLDVDMDN
AMASRKQINELPDTKVSFNDLVVKASAMALRKHPQINTEWTVEKTIYNEHIAIGVAVAIE
DGLVVPVIPFTDTKSLTQIGAEVKDLAIKAKNKKLTPAEMSGSTFTVSNLGMFGVDNFTS
IINQPNSAILSVGGIKQKPVVKNGEIVVGNVMNLTLSCDHRTIDGAVGAAFLNTLKQYIE
NPVTMIA
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggctactataattaacatgccacgtttgagtgatacgatgactgaaggaaccgttgct
caatggcttaaaaaagttggagacaaaattgaagaaggtgacattttagctgaaatcgaa
actgataaagctactatggaatttgaatcttttaacgaaggtgttttattacacattggt
ttagaagatggagaaacagcacctgttgatagtttattagctatcattggtgaagaaggt
gaagacatttctggattattaggtggtggttctgctgaacctgctgctgaagcaccaaaa
actgaggaagctgctcctgttgcagaagaagctcctgcaagtgaagaagttgctatccct
gaaggagtaattgttgtgacaatgcctcgtttaagtgatacaatgactgatggtactgtt
gcttcttggttaaagaaagttggagacaaggttgaagaaggtgatattttagctgaaatc
gaaacagataaagctacgatggagtttgagtcttttaacgaaggaactcttttatatgtt
ggactagaagaaggagaaactgctcctgttgatagtttattagcaattattggtgaagct
ggaactgatgtttctgctgtagctgctaattttggtaaagcaagtgctccagctcctaaa
gctgctcctgctgccgaagcgccaaaagctgctgccgctcctgctccagcaaaaacagag
gctcctaaagcatctgctcctactgctactaaaaaagtaagtgcaatcaattctgaaaac
ggaagaatcgttgcctctcctttagctaaagctttggctgaagaaaaaggaatcaactta
gcaaaagttgtaggtactggtgaaggtggaagaattgtaaaagtagatatcgagaactat
actcctgctactgaagctgctgctcctgctgcgaaagctgtagctgctgctcctgctgga
gaaattagccaaagagaagagaaaaactctaacatgcgtaaagcaattgctagagcttta
gacaaatctcaaacggaaaatgtaaactttactattagtttagatgtagacatggacaat
gccatggcttctcgtaaacaaattaatgagttacctgatactaaagtttcttttaatgac
ttagtagtaaaagcttctgcaatggcattgagaaaacacccacaaatcaatactgaatgg
actgttgaaaaaacaatctataacgaacatattgctattggtgttgctgttgctattgaa
gatggtttagtagttcctgtaattccttttacagacactaagagtttaactcaaattggt
gctgaagtaaaagacttagctatcaaagctaaaaacaaaaagttaactcctgcagaaatg
tctggaagtacttttacagtatctaacttaggaatgtttggtgtagataactttacttct
atcatcaatcaacctaactcagctattttatctgttggtggtatcaaacaaaaacctgtt
gttaaaaacggagaaattgttgttggtaacgtaatgaatttaactttgtcttgcgaccac
agaactattgatggtgctgttggagctgctttcttaaatacattaaaacagtatatagaa
aaccctgttactatgattgcttaa

DBGET integrated database retrieval system