Weissella hellenica: EFA59_02225 Help Entry EFA59_02225       CDS       T06311                                  Name (GenBank) phosphocarrier protein HPr   KO K02784   phosphocarrier protein HPr Organism whe  Weissella hellenica Pathway whe02060   Phosphotransferase system (PTS) Brite KEGG Orthology (KO) [BR:whe00001]  09130 Environmental Information Processing   09131 Membrane transport    02060 Phosphotransferase system (PTS)     EFA59_02225  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:whe02000]     EFA59_02225 Transporters [BR:whe02000]  Phosphotransferase system (PTS)   Enzyme I and HPr    Phosphocarrier protein HPr [TC:8.A.8]     EFA59_02225 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PTS-HPr Motif Other DBs NCBI-ProteinID:  QDJ58399 LinkDB All DBs Position 467107..467373 Genome browser AA seq 88 aa AA seqDB search MESREFHIVAETGIHARPATLLVQAASKFSSNVTLSYQGKDVNLKSIMGVMSLGVGQNAD VKISAEGDDEADALAAIAETMSTEGLTD NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggaatcacgcgaatttcacattgtagccgaaactggtatccacgcacgtccagcaact ttgttggtacaagcagcttcaaagttctcatcaaacgttaccttgtcataccaaggtaag gatgtaaacttgaagtcaattatgggtgttatgtcattgggtgttggtcaaaatgctgac gttaagatttctgcagaaggtgatgacgaggctgatgccttggcagctattgcagaaaca atgtcaactgaaggtttgactgattaa

DBGET integrated database retrieval system