KEGG   Wallemia ichthyophaga: J056_002379Help
Entry
J056_002379       CDS       T03457                                 

Definition
(RefSeq) DNA ligase 4
  KO
K01897  
long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
wic  Wallemia ichthyophaga
Pathway
Fatty acid biosynthesis
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Peroxisome
Module
beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:wic00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    J056_002379
   00071 Fatty acid degradation
    J056_002379
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    J056_002379
Enzymes [BR:wic01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     J056_002379
Lipid biosynthesis proteins [BR:wic01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   J056_002379
Exosome [BR:wic04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   J056_002379
  Exosomal proteins of breast cancer cells
   J056_002379
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 1848 aa AA seqDB search
MSSPSRDEIKQAAASKQGDIRIEKDSTAYAEYHPIERPAGVSNTGSMKYAQLVSFFDNIT
NEKNVSMRSLKLAKLFDYHREHYGNDFYNLLRLMIPERERERSMFGIKETVLAKIYVELL
GLSPKHNDGHRLLSWKAPTAAHTVSGDFPSVLVDVMKNRVSYDSKSSFTIDEVNHKLDQL
SRAKSFQRKKDIMKEFAKRCDTEEQFWLVRILLKNLKISIRERSILSQFHPDAYALFEVT
TDLRTVAYRLYDPSMRLRDADSSVHLFQVFQPMLCKRNTIPDVHKKMPHGRWVVEEKMDG
ERIQLHRKGDRYKYWSRKAKDYTYLYGKSPTDGSLTPFIHTTFDSRVDEVVLDGEMLAYS
GAIDAVLPFGTLKKAAKGDIGTHPIFKVFDVLWVNGKDISAYPFKERQKVLRSIFTELPT
RFEHVSRWTVGDVVELKGSLERIILQKGEGLVVKSPLSTYEYGGRSDRWIKLKPDYFDEM
SETADLLVIGGNWSNSRNGVISTLFCALVDDREENIAADPQYILFARAGTGYSAQDLVII
NELFAKADTRKYTPASVYPGVKIGNETPDVVINPQQSFVVEIKASDINPSTQYPTGCTYR
FPRFKRLRLDKGSGDKSPFDPDSLFKWTEMDSMIKGIKASRSHQAEAKVKEKQAKPTRAS
KKQVISSRAVASVRADTRNYRNTLFEGCAFRILNGTNELEVKDLAVLIAERKGMALSHIP
RDEDCPEPLLVIAGKATAVQVSQLVKLQRRSILSAQWLLECVQYNCIVPLEGAGSGAYWV
YQCDVDSQLILDTLRPFFITPDHIPHEQAERLAHGQLDLEAVGEINELRFTQEPALQVEE
KVATIVPEEEDSETEKESLGESGDDGDETIQEGAFTAQKSPSPRLGPSQLTYTQTSSTRT
VTRQKGSTSNNFDDSSDEGDDSVKIKKEATQLFSPTTNPQSPHQENREDVQKEQPSIIRD
DADPDRTLEEDAVATLEEEENVKTSGTTGTLVLNQQEMHDKVDKGRRRSRVVAFDSDYKT
NSEIDVEDASAKKSKKIKQEGDSEEMHEHELGETSKASKQHESLNAADVDLSADHPREPE
VVEEAVVITSDDLDKPLLNVAVYVDDYENAITNDLFPRPSIMSKTDWTGIRDKITRLGGM
VAEVDDSRLTHIVIDENDKRRVEELFERTKRPKYRKLPTPGSATANSTAIYKDAIWGEKP
RPEFGVETIYDLFQHSAAHAGDKNFLGHRPYNPNKQRFERYYEYQSYNEIAQRRTNLGSG
ISQLVKQGDLGDSCFSGWTAGTWSKNCPEWQIADLSLHAFSRISVPLYDTLGNDSVEYVI
NHSENRLIFTSSSHLPQLYKILHNCPSVEAVIVLDGLDEPGAPQDGARVPGQLSRADVLK
LWAKNLNVRLYSLAQVEELGAIHQHPHIPPKPTDVLTISYTSGTTGWPKGAVHTHSSMCN
NILSLTTGMDEYVGHLLASYMPLAHVLQRALEFIAMVLLAPIAYTTGDILRLMEDLQIMQ
PELMVTVPRVLNRIYAGIKHQMDTPGVKGSLLTRAVAAKIDKMHKTSDTTHLLWDKLIFN
KIRQVLGGKIRLIITGSAPISPRVLDVLKVSLCIPIIEGYGLTETCICTRTIPSDPLSSG
YVGNMNPGFEIKLVDVPEMNYFSTDRPYPRGEICIRSKSSMREYYKDSDKTKESFTDDGF
FISGDIGQIDNHGRLKLIDRKKNIFKLAQGEYIAIEKLEGVFALCPTVMQLYIHADSLRS
YLVAVVVPDPLELGSVVGCDANDRQALDTAIASEKVRGMIMAEIDKASNHAGLKGFERIK
AVHITNDQFTIDNGLLTPTLKVKRNEVASKYKTTIDALYDANDKSAKL
NT seq 5547 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgcccagcagagatgaaattaagcaggcagcggcgagtaaacagggtgatatc
aggatagaaaaggactccactgcttacgctgaatatcacccaattgagcgtcctgctggc
gtttccaatactggatcaatgaaatacgcccagctagtctcattctttgacaacatcaca
aacgagaaaaatgtttcaatgcgctctttaaagttggcgaagctgtttgactatcaccgg
gagcattacggcaatgatttctacaatctactccgcttgatgatcccagagcgagagaga
gagcgcagtatgttcggcatcaaagagactgtcctcgcaaagatatacgttgagctactc
ggtctctcccctaagcacaatgatggtcaccgtctactctcctggaaagctcccaccgct
gcacatacagtcagtggtgacttccccagcgtgctggtagacgtaatgaaaaaccgcgtc
agctacgattcaaagtcatcgtttaccatcgacgaggtgaatcacaagcttgaccagctc
tcgcgcgccaagtctttccagcgaaagaaagacatcatgaaagaattcgcaaaacgttgc
gatacagaagagcaattctggctcgtgcgtatcttactaaagaatcttaaaattagcatc
cgcgagagaagcatcctgtctcaattccatccagatgcatacgcgctgtttgaagtgacg
acagatttgcgcacagttgcctacaggctgtacgacccgagtatgcggctgcgcgatgct
gatagctccgttcacctcttccaagtattccagccgatgttgtgcaagcgcaataccatc
cccgatgtccacaagaagatgccgcacggccgctgggttgtcgaggagaagatggacggc
gagcgcatacagctacatagaaagggcgacaggtataagtattggagtaggaaagctaag
gattatacctatttatatgggaaatccccaaccgatggcagccttacaccgtttattcac
accacattcgattctcgcgtcgatgaagtcgtgcttgatggagaaatgctggcgtattca
ggcgcaattgacgccgtactcccttttggcactcttaaaaaagccgcaaaaggcgatatt
ggtacacatccgatatttaaggtattcgatgtgctctgggtaaatgggaaagatatctct
gcatatccatttaaagagcgccagaaagttctccgctccatattcacagagctacctaca
cgcttcgagcatgtttcacgctggactgtgggcgatgtggtagagctaaagggatcgctt
gagcgtattatcctccaaaaaggcgaagggctggtggttaagtcgcccctatcaacatac
gaatatggcggtcgatcagatcggtggatcaagctgaaacctgactactttgatgaaatg
tcagagaccgccgatctgctagtaatcggaggcaactggtctaacagtcgcaatggagtg
atttccaccctcttctgcgcactagtggatgacagggaggagaacatagcagcggatcct
caatacatactcttcgcgcgtgctggaacaggctactcggcgcaggatctcgtcattatt
aatgagctattcgctaaagcagacacgcgcaagtacactcctgcatctgtataccctggt
gtcaaaataggcaacgagacaccggatgtagtcatcaaccctcagcaatctttcgtagtc
gagatcaaggcaagcgatatcaatccatcgacgcaatatcccaccgggtgcacctaccgc
tttccccgcttcaagcgcctcagattggacaagggcagcggggataagagccccttcgat
ccagacagtctgttcaagtggacggagatggacagcatgatcaaaggtataaaggcttcg
cgctctcatcaagctgaagctaaagttaaagaaaagcaagccaagccgacgagggcgagt
aaaaaacaggttatcagctcgcgtgctgtggccagcgtgagagctgatacacgcaactat
cgcaacacgctcttcgaaggctgtgcattccgaatactgaacgggacgaacgagctcgaa
gtgaaagaccttgcggtgctcatcgccgaaagaaaggggatggcactgtcgcacataccc
agagacgaagactgccctgaaccgctgctcgtcattgcaggtaaagctacagctgtgcag
gtctcccagctcgtcaagttgcaaagaagatctatcctgagtgcacagtggctgctcgag
tgcgttcaatataactgtatcgtgccactagagggcgctgggagtggtgcgtattgggtc
tatcagtgtgacgtcgatagtcaacttattttggataccctccgtcctttcttcatcacc
ccagatcatattccacacgaacaagcagaacgtcttgcccacggtcagctcgatttagag
gccgtcggtgaaattaatgaactgagattcacacaagagccagcgttgcaggtagaggag
aaggtggccacgattgtgcctgaggaggaagatagtgagacagagaaagaaagtctggga
gagagtggcgacgatggcgatgagactatacaagaaggcgcttttacagcccagaaatca
ccttcaccacggttaggaccatctcaactgacttatacacagacatcctcaactcgcaca
gtgaccagacaaaaaggtagcacgtctaataatttcgatgatagctctgatgagggtgat
gatagtgtgaagatcaagaaagaagcgactcagcttttctcaccgacgacgaatccacag
tcgcctcatcaggaaaatcgggaggatgtgcagaaggagcagccgtcgattatacgagac
gatgcagatcccgataggaccttggaagaagacgccgttgcgacgctcgaggaagaagag
aatgtcaagacatcaggtaccacaggaacactagtactcaatcagcaggagatgcatgat
aaggttgataagggcagaagacgtagtagagtggttgcgtttgacagtgattataaaact
aatagcgagattgatgtggaggatgcatccgccaagaagagcaagaaaataaagcaggaa
ggtgatagcgaggagatgcacgagcatgaacttggtgagacatcaaaagcatctaaacag
catgaatcacttaatgctgccgatgttgatttgtcagctgatcatccacgtgagccagaa
gtagttgaagaagcagtagtgattaccagtgatgatctagataaaccgctgttgaatgtc
gctgtgtatgttgacgattatgagaacgcaatcacgaacgacctgttcccgcgtccatca
ataatgagcaagacagattggaccggtatccgagacaagataacaaggcttggcggaatg
gtagcggaggtggacgacagcaggctaacgcatatagtaattgatgagaacgacaagaga
agagtggaggagctgtttgagcggacaaagcggcccaaataccggaagcttcctacgcct
ggttcagctacagcaaattctacagcaatctacaaagacgcgatctggggagagaaacca
cgcccagaatttggtgttgagactatctacgatctattccagcactcagctgcacacgct
ggcgataagaatttcttaggtcatcgaccatacaatcctaataagcaacgctttgaacgc
tactacgagtaccaatcatacaatgaaatagcccagcgccgcacaaatctcggctctggc
atctcacagctcgttaagcagggcgatttgggtgactcttgcttctctggctggacggct
ggcacgtggtccaaaaattgtccagaatggcaaatcgctgatctcagcttacacgctttt
tcgcgcatttctgttcctctctacgataccctcggcaatgacagcgttgaatatgtcatc
aaccacagcgaaaataggctcattttcacttcatcttcccatcttcctcagctttacaag
attctccacaactgcccgtctgtcgaagccgtcatcgtcctcgatggtctcgacgaaccg
ggtgctccccaggatggcgcacgcgtaccaggccagctcagccgcgctgacgtgctcaaa
ctctgggcgaagaatttgaatgtcagactttatagcctggcccaagttgaagagcttgga
gctatccaccaacaccctcacattcctccaaaacctaccgatgttttaacaatctcgtat
acttctggaacaacgggttggccaaaaggcgcagttcatacacatagcagcatgtgcaac
aatatcctttctttgactacaggcatggatgaatatgttggtcatctgctcgcaagctac
atgccactcgcacatgttctgcaaagagcactcgagttcatagccatggtgttgttggcg
cccatcgcttacactaccggcgacatactccgcttgatggaagatttgcagattatgcag
cctgaacttatggtcaccgtaccaagagttctgaatagaatctacgccggcatcaagcac
caaatggacactccaggtgtaaaagggtctcttctcacccgcgccgtcgctgccaagatc
gacaagatgcacaaaacatccgacactacccatctactctgggacaaactcatatttaac
aagattcgacaagttttgggtggcaagattaggttgataattacaggttcggcaccaatc
agtcctcgagtgctcgacgtgcttaaagtcagcctgtgcatcccgattattgaaggctac
ggtctcactgaaacgtgtatctgcacgagaacgattcctagtgatcctctgtcgtctgga
tatgttggaaatatgaacccaggcttcgagatcaagctggtagatgttcccgaaatgaat
tacttctcaactgataggccatatccacgcggggaaatttgcatcagatctaagagctcg
atgagagagtattacaaggattctgacaagacaaaagaatcattcaccgacgatggcttc
ttcatcagtggtgacattggccaaatcgacaaccacggccgtctcaagcttattgacaga
aaaaagaacatatttaagctggcgcagggcgaatatattgccattgagaagctggagggt
gtttttgcgttgtgtccgactgtcatgcagctttacatccacgcagatagcctcagatct
tatctcgtcgccgtggtcgtcccagatcctctcgaacttggttctgtggtaggctgtgac
gctaacgatcgccaagctcttgacacagcaattgcaagcgagaaagtgcgtggtatgatt
atggcggagatcgacaaagcatctaaccatgctgggctgaaaggcttcgaacgtatcaag
gctgttcacataactaatgaccagtttaccatcgataacggcttgctcacacctactctt
aaagtcaagcgcaatgaagtggctagcaagtacaaaaccacaattgatgctctatatgac
gcgaacgacaagtctgccaagctttga

DBGET integrated database retrieval system