KEGG   Wallemia ichthyophaga: J056_003233Help
Entry
J056_003233       CDS       T03457                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
wic  Wallemia ichthyophaga
Pathway
wic03030  DNA replication
wic03410  Base excision repair
wic03420  Nucleotide excision repair
wic03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:wic00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    J056_003233
   03410 Base excision repair
    J056_003233
   03420 Nucleotide excision repair
    J056_003233
   03430 Mismatch repair
    J056_003233
Enzymes [BR:wic01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     J056_003233
    6.5.1.6  DNA ligase (ATP or NAD+)
     J056_003233
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     J056_003233
DNA replication proteins [BR:wic03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    J056_003233
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     J056_003233
DNA repair and recombination proteins [BR:wic03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     J056_003233
   NER (nucleotide excision repair)
    Other NER factors
     J056_003233
   MMR (mismatch exicision repair)
    Other MMR factors
     J056_003233
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 20376185
NCBI-ProteinID: XP_009270485
UniProt: R9A9C8
LinkDB All DBs
Position
Unknown
AA seq 707 aa AA seqDB search
MLSNKRVIESPSSSEAEQSSAKENTVKRVKKNSPVKAEKDEKVKEKKIHPMFLPKQQISQ
DKEDKRLVREEVAATASSKSNASSKTNNFNDTITFAQLADTFTNIESTSKRLEIADHLTQ
FYKHVILTKPAELLMTVYLSLNRLCPDYEGLELGIGEGLLIKAIVESTGRTTAKVKEDFK
KAGDLGTVAQLARKNQPTMFKAKGLNVPSVFKNLKEIATASGNQSQTKKIGIIMKMLTNC
DSSTNEAKFLIRLLEGKLRIGLAERTVVVSLAHAIVLSRDEKATKEDLEKGVEVVKQVYS
ELPSYDMIVPALLDGGINDLQERCHLTPGIPLKPMLAKPTKAVSEVLDRFEGKSFTCEYK
YDGERAQIHYHDGKVKVFSRNSEDMSNKYPDLVEQLPRAIKPGVKNFVIDSEAVAFDKQT
KNILPFQELTRRKRKDVKVEDITVKVHIFAFDLLYFNDKPLLHEDLTYRRKLLSENFVQV
EDEFAMAKSMEAQSTEEIGVFLEESVRDSCEGLMVKLNLGESAWYTPSKRSMNWLKLKKD
YLAGAGDSLDLVVIGGYHGKGKRTNVYGAYLLACYDEDSESYQSICKIGTGFSEEMLEQH
YKLLNPLEITVPKSYYKLGTAKPDVFFEPQAVWEVLTADLSLSPVYTAASGEISERGISL
RFPRFIRVRDDKGAEDATTSDQVADMYRNQASAQQKATKADIDDDAY
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgctcagcaacaaacgcgtaatcgaatcaccttcctcctcagaggctgagcagagctcg
gcgaaggaaaacacagtaaagcgcgtcaagaagaactctcctgtgaaggctgagaaggat
gaaaaggtgaaggagaagaaaatccacccaatgttcctccccaagcagcagatttcgcag
gataaggaagataagaggttagtgagggaggaagtggcagcgaccgcaagtagcaaatca
aacgcgtcttccaagacgaacaatttcaacgacaccatcacatttgctcagctagcagac
acattcacaaacatcgaatcgacatcgaaacgcttagagattgcggaccacttgacgcaa
ttctacaaacacgtcattttaactaagccagcagagctgctgatgacggtatacctctcg
ctcaaccgcctttgtccagattacgaggggttggagttgggtattggggagggtttgctt
atcaaggccatagttgaatcaacgggacgcaccaccgccaaggtcaaagaggacttcaag
aaggctggtgatctcggcacagttgcgcaactggccagaaaaaaccaaccaacaatgttc
aaagctaagggtttgaatgtaccaagtgtgttcaagaatctcaaagagattgcaacggct
tctggaaatcaatcgcaaactaagaagataggtatcataatgaaaatgcttacgaattgt
gactccagcacgaacgaagcaaagtttctaattagactgctagaaggtaaactgcgtatc
gggttggctgagagaactgtggtggttagtttggctcatgcgattgtgttatcgcgcgat
gagaaagctacgaaggaggacttagagaagggtgtagaggtggtgaagcaggtgtactcg
gagctcccttcatatgatatgatagtacctgctttgctagatggcggtatcaatgatcta
caagaaagatgtcatcttacaccaggtataccactcaaacctatgctggccaagcctact
aaagcagtttcagaagtgcttgatagattcgaagggaagagtttcacatgcgaatacaaa
tacgatggtgagcgtgcccagatacactaccacgacggaaaggtgaaggtgttctctcgt
aattccgaagatatgtcaaacaaatacccagacctcgtcgagcaacttccacgcgctatt
aagcccggtgtcaagaattttgtcatcgacagtgaggctgtcgctttcgacaaacagaca
aagaatatattacctttccaagaactgacgcgtcgtaagcgcaaagatgtaaaggtggaa
gacattacagtcaaggtgcatatctttgctttcgatctgctctatttcaacgacaagccg
ctgctgcatgaagatctcacatacagacgcaaacttttgagtgaaaactttgtccaggtc
gaggatgagttcgctatggccaagtcaatggaagcgcagtcgacagaagagattggtgtg
tttctggaagagagtgtgcgagacagctgcgagggactgatggtgaagctgaaccttggt
gaaagtgcttggtacaccccttcgaaacgttcgatgaattggctgaaattgaagaaggac
tatctagcaggtgctggagactcgcttgatttagtcgtcattggtggttaccacggaaaa
ggcaaacgtacgaatgtttatggtgcttatctcctcgcttgctacgatgaggacagcgaa
tcatatcagagtatatgtaaaatcggtactgggttcagtgaagagatgctagagcaacac
tacaagctcctcaatccgctcgaaattacagtgcctaaatcatactataaattgggcact
gcgaaacctgatgttttctttgagccccaggctgtatgggaggttttgactgctgatcta
tctctatctcctgtttataccgcagcgtcaggtgagatttctgaaagaggtatcagtttg
agattcccgcgctttatcagagtcagagacgataagggagcggaggatgcgacgacatca
gatcaggttgctgatatgtatagaaatcaagcgtcggcacagcaaaaagccactaaggct
gatatcgacgatgacgcatattag

DBGET integrated database retrieval system