KEGG   Winogradskyella sp. PG-2: WPG_0993Help
Entry
WPG_0993          CDS       T03603                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
win  Winogradskyella sp. PG-2
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:win00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WPG_0993
  Amino acid metabolism
   00310 Lysine degradation
    WPG_0993
   00380 Tryptophan metabolism
    WPG_0993
Enzymes [BR:win01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     WPG_0993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1097847..1100612)
Genome map
AA seq 921 aa AA seqDB search
MDKYSFLNAAHTAYFADLYEQYLENPDSVEPSWRAFFQGYDFGSESYGMEGEIIEGVSTQ
IPEQLQKEFQVLKLIDGYRIRGHLFTKTNPVRARRQYAPTLEIENFGLSKSDLNSTFSAG
EILGLGSASLQSIIDHLENIYCDSIGVEYMYIRKPEEIQWIQDKLNVNDNHTKFTSDEKK
YILKKLNQAVAFESFLHTKYVGQKRFSLEGNESLIPAVDAIIEKAADEGVKEFVMGMAHR
GRLSTLTNIFGKSAKDIFSEFDGKDYEEKVFDGDVKYHLGWTSNRETYNNKKINLNIAPN
PSHLETVGAVVQGITRAKQDKDEITDPSQVLPIVVHGDAAIAGQGLVYEVVQMAKLDGYK
TNGTIHIVVNNQIGFTTNYLDGRSSTYCTDVAKVTLSPVLHVNSDDAEAVVHAALFALHF
RMKFKRDVFIDLLGYRKYGHNEGDEPKFTQPLLYKAIAKHSNPRDIYAQRLLEEGIIEEG
YVKHIESKYKEKLEENLEDSRKEDKTEITAFMQEEWKGLTRVTESVMMEQVDTTVSKTVL
KNITKVISNLPSDKKFIRKIQRLIESRQTMFDENRLDWAMGEHLAYGSLLTEGFNVRISG
QDVERGTFSHRHAVVKVEDSEEEIILLKNVTEKQDQFNIYNSLLSEYGVVGFDYGYAMAS
PNTLTIWEAQFGDFSNGAQIMIDQYISSGEDKWKTQNGLVMLLPHGYEGQGAEHSSGRME
RYLQMCAKDNMFIADCTTPANMFHLLRKQMKANFRKPLIVFTPKSLLRHPKVVSSVDEFA
KGSFQMLIDDETAKPDKVKTLVFVTGKFYYDLLEEQENLNRDDIALVRLEQLFPLPVEAM
TDVIEKYKNVEDVVWAQEEPRNMGAYSHMLMHFNESRSWRAATRRPYGAPAAGSSVRSKI
RHKEVIDYVFDKSKNNQRQKK
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atggataaatattcctttctcaacgcagcacatacagcatattttgctgacttatacgaa
caatacctagaaaatcctgattctgtagaaccaagttggcgtgcctttttccaaggttac
gattttggttcagaaagttatggaatggaaggtgaaattattgaaggtgtatcaactcag
ataccagaacaacttcaaaaagaatttcaggttttaaagctaattgatggttatagaatt
agagggcatttatttacgaaaacaaatccagttagagcaagacgtcaatatgcgccaaca
ctagaaattgaaaattttggcttatctaaaagtgatttaaactctacattttctgctggt
gaaatcctaggtttagggtcagcatcattgcaaagtataatcgatcatttggaaaatatt
tattgcgattctataggtgtagagtacatgtatattcgcaaacccgaagaaattcaatgg
attcaggataaactaaatgtcaatgataatcacactaaatttacttcagacgaaaagaaa
tatattttaaagaaattaaatcaagctgttgcttttgaatcttttctccacacaaagtat
gttggtcagaaacgtttttctttagaagggaatgaatctttaattcctgcagttgatgct
attatagaaaaagcagcggacgaaggtgtaaaagagtttgttatgggcatggctcataga
ggtcgactcagtacattgactaatatttttgggaagtctgctaaagatatttttagcgaa
tttgatggtaaagattatgaggaaaaagtatttgatggtgatgtaaaatatcatttaggt
tggacgagtaatcgtgaaacatataacaataaaaaaatcaatcttaatatagctccgaat
ccttctcatttagaaacagtcggcgcggttgttcaaggaattacaagagcgaagcaagat
aaagatgagattacagatccatctcaagtacttccaattgttgtgcatggagatgctgct
attgctggtcaaggtttggtttatgaagttgtgcagatggctaaattagatggttataaa
acaaatggaactatccatattgtagttaataatcaaataggatttacaacgaactattta
gatggccgctcaagtacttattgtacagatgtggcaaaagtaacattatcacctgttctt
catgttaattcagatgatgctgaagctgttgtgcatgctgcgctttttgcgctacatttt
agaatgaagtttaagcgcgatgtttttatagatttactagggtatagaaagtatggtcac
aatgaaggtgatgaacctaaatttacacaacctttattatacaaagcgattgcaaaacat
agtaaccctagagatatttatgcacagcgtttattagaagaaggtatcattgaggaaggt
tatgtaaaacatattgaatctaagtataaagagaagttagaagagaatttagaagactca
cgtaaagaggataaaacggagataacagcttttatgcaagaagagtggaaaggtcttaca
agggttacagaaagtgtaatgatggaacaagtggatacaaccgtatctaaaactgtttta
aaaaatattactaaggttatttctaaccttccttcagacaaaaagtttattcgtaaaatc
caaaggttaatagaatcacgtcagactatgtttgatgaaaatcgattagactgggcaatg
ggagaacatttggcttatggttcacttttaactgaaggctttaatgttagaatttctgga
caagatgtagaacgtggtacattctctcatcgacatgctgtagttaaagtagaggatagc
gaagaagaaattattttattgaagaatgttactgaaaagcaagatcaattcaatatatat
aattcattattatcagaatatggcgttgttggttttgattatggttatgctatggcaagc
cctaataccttaactatttgggaggcacaatttggtgatttcagtaatggagctcaaatt
atgatagaccaatacatatcctctggtgaggataagtggaaaactcagaatggtttggta
atgttattgccacatggttatgaaggtcaaggagcagagcattcttctggtcgtatggaa
cgttatttacaaatgtgtgctaaggataatatgtttattgcagattgtacgactccagca
aatatgtttcacctattacgtaaacaaatgaaagctaattttagaaagcctttaattgtt
tttacacctaagagtttgttacgtcatcctaaggtagtatcatctgttgatgagttcgct
aaagggagttttcaaatgcttattgatgatgaaactgctaaaccagataaagtaaaaact
ctagtatttgttacaggtaagttctattatgatttactcgaagaacaagaaaatttaaat
agagatgatatagcactggtaagattagagcaactatttccattaccagtggaagcaatg
acagacgtaatagaaaaatataaaaatgtagaagatgttgtttgggcacaagaagaacca
agaaatatgggtgcttatagtcatatgttaatgcattttaatgagtctcgaagttggaga
gcagcaactagacgaccatatggtgcacctgcagcaggaagttctgtgcgttcaaaaatt
agacataaagaagttatagattacgtttttgataaatccaaaaacaaccaaagacaaaaa
aaataa

DBGET integrated database retrieval system