KEGG   Wolinella succinogenes: WS0438Help
Entry
WS0438            CDS       T00146                                 

Gene name
DDLA
Definition
(GenBank) PUTATIVE D-ALANINE--D-ALANINE LIGASE
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
wsu  Wolinella succinogenes
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    WS0438 (DDLA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    WS0438 (DDLA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    WS0438 (DDLA)
Enzymes [BR:wsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     WS0438 (DDLA)
Peptidoglycan biosynthesis and degradation proteins [BR:wsu01011]
 Precursor biosynthesis
  Amino acid ligase
   WS0438 (DDLA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(432721..433758)
Genome map
AA seq 345 aa AA seqDB search
MNLAVIFGGASYEHEISIVSAISLKKILPALEHFIFVDGNRDFYWIPASEMRSKHFADGI
YKKNPKLFLRPGGFYAKGLWGEKRVPFDTALNLIHGGDGEDGKLASLLEFFRIPFIGPRI
EASVMSFNKHLTKLYAKERGVKTLPYLLARKNEKREFGNEFPLIVKPLRLGSSIGVSIAK
NRQELDYALDVAFEFDEAALLEPFMQGIKEYNLAGCKINGEYHFSIIEEPQKKEFLDFDK
KYLDFSRTQKLLKADLSEASERLLKEAFIKLYDDSFEGSLIRCDFFVQNQEVFLNEINPI
PGSLANYLFEDFPKILQSLAHNLPKERGIKIDYRYIHQIQKAKGK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
ttgaatctagccgtgatttttggtggcgcaagctatgagcacgaaatcagcattgtcagc
gccatttcactcaaaaaaattcttcccgctttagagcatttcatcttcgtggatgggaat
cgtgacttctattggattcctgcgagcgagatgcgctccaagcactttgccgatgggatc
tacaagaaaaaccccaagctctttttgcgccctggaggcttctatgctaaagggctttgg
ggcgagaagagggttccttttgatacggcactcaatctcatccatgggggcgatggcgaa
gatggaaaactcgcctcccttctagagtttttccgtattcccttcattggccctcgaatc
gaagcgagcgtgatgagcttcaataaacacctcaccaagctttatgccaaagagcgtggc
gtgaagaccctcccctatcttctggctcgaaaaaatgagaagcgtgagtttggcaatgag
ttccccttgattgttaaacccttgcgcctagggagctctattggcgtgagcatcgcgaaa
aatcgccaagagctcgattatgccctagatgtggcctttgagtttgacgaggctgctctt
ttggagccctttatgcagggaatcaaagagtacaatctcgcggggtgcaaaatcaatggc
gagtatcacttctccatcattgaggagccccaaaagaaagagtttctcgactttgacaag
aagtatctcgacttctctcgcacccaaaaactcctcaaagccgatctctccgaggcgagc
gagcgactgcttaaagaggcgttcatcaagctctatgatgactcgttcgagggaagcctc
atccgttgcgatttctttgtgcaaaatcaagaggtgtttctcaatgagatcaaccctatc
cccggcagcctagccaactatctctttgaagatttccccaagattcttcaatctctcgcc
cacaacctgcccaaagagcggggcatcaagatcgactaccgctacatccatcaaatccaa
aaagccaaaggcaagtag

DBGET integrated database retrieval system