KEGG   Weeksella virosa: Weevi_0481Help
Entry
Weevi_0481        CDS       T01441                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
wvi  Weeksella virosa
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:wvi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Weevi_0481
  Amino acid metabolism
   00310 Lysine degradation
    Weevi_0481
   00380 Tryptophan metabolism
    Weevi_0481
Enzymes [BR:wvi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Weevi_0481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(482543..485338)
Genome map
AA seq 931 aa AA seqDB search
MLNKPYFCNSISQRVIFMDRFSFLNAAHINYISDLYDQYLQYPDSVDAGWRVFFQGYDFA
NQTYNGEPLSSETSGNTDLVPEKVQKEFNILNLIDAYRTRGHLFTKTNPVRERRKWSPDL
DIAHFGLTDADLDETFNAGSVMGIGGPRTLREIIQHLEGLYCDSIGVEYMYIRDPEKIRW
IQEWLNNNLNHVQFTKEEKERILSKLNEATVFENFLNTKFVGQKRFSVEGNESLIPGLDE
LINTSADKHGVEEVIIGMAHRGRLNTLANIFRKPYSHIFSEFEGKPFDDDLVAGDVKYHM
GSSTSVETVGGKKIKINLAPNPSHLETVDAIVLGIARAKIEQDYQEDYSKVLPINIHGDA
AIAAQGIVYEVVQMMNLDGYKTGGTVHVVVNNQIGFTTNYLDGRSSIYCTDIAKVTLSPV
MHVNADDAEAVVRAMRFAADYRARFQQDVFIDLLGYRKYGHNEGDEPKFTQPKLYSIIAK
HPNVREIYKDKLLKEGTIGENIVAEKEKEYKDLLEEKFNESKTIEKNTLDAFMPEVWKDY
HIATRAEVLAKADTTFPKEKLKEIVDTIAVVPEGKKLIRKVSRLIEARAKGVAEDKIDWG
TAELMAYGSVLLEGYDVRLSGEDVERGTFSHRHAVIKTEDTEEEIILLNEIRKEQGVFRV
YNSLLSEYGVLGFDYGYAMAYPKGLTLWEAQFGDFANGAQIIIDQYISAAEDKWKMQNGL
VMLLPHGYEGQGAEHSSARMERFLQLAAENNMFIVDITTPANFFHALRRQVVTNYRKPLV
VFSPKSLLRHPEVVSTMDEIANGEFQEIIDDATADPKKVTKLVFCTGKIYYELKSYREEI
GDDKTALVRIEQLYPIDEEKLEAIIKKYKNQKQLIWAQEEPENMGAWGYILRKFRKLPFD
VVCPAESGSPAPGSSKTSAIIQQDTIERVFK
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgttgaataaaccctatttttgtaactcaatctcacagagagtaatttttatggatcgt
ttttcatttttaaacgccgctcatattaattatataagcgacttatatgaccaatatctc
cagtatcctgatagtgttgatgctggttggagagtattttttcagggttatgattttgct
aatcagacctataatggtgaacccctatcaagcgaaacttctggcaacactgatcttgtg
ccagaaaaagttcagaaagaatttaacattcttaatctgatcgatgcttaccgcacacga
ggacacctttttaccaaaacaaatccggttagggaacgcagaaaatggtcacctgacctt
gatatagctcattttgggcttaccgatgctgatttggacgaaaccttcaatgcaggaagc
gttatgggaattggtgggccacgaacgttgcgtgagattattcagcacctagaaggcttg
tattgcgactctatcggggtagaatatatgtatatccgagacccagagaaaattcgctgg
atacaagaatggttgaataataatctcaatcatgttcagtttaccaaggaagaaaaagaa
cgtattttatcaaaactaaacgaagcgaccgtattcgaaaacttcttaaacaccaagttt
gtaggacaaaaacgtttttcggtagaaggaaacgaatcgttgattccaggtttggatgaa
ttaattaatacttcagcagacaagcatggagtagaagaggtaataattgggatggctcac
cgtggacgtcttaatactttagcaaatatatttagaaaaccttattcgcacatttttagt
gaattcgagggaaaacctttcgacgatgatttggttgctggggatgtgaaataccacatg
ggatcttctacaagtgtagaaacagtgggtggtaaaaaaatcaaaataaatttagcaccg
aatccttcacatctagaaactgttgatgcaattgtgttagggatagcacgggctaaaata
gagcaagattatcaagaagattactcgaaagtattgccaatcaatatacatggtgatgct
gcaattgcggcacaaggaattgtatacgaagtagttcaaatgatgaatctggatggctac
aaaacaggaggaactgttcatgttgtagtcaataaccaaattggctttacaacgaattat
ttagatgggcgttcgtcaatatattgtaccgatatagcaaaggttaccctttctcctgta
atgcatgttaatgccgatgatgcagaggctgtagtacgtgcaatgcgatttgcagccgat
taccgagcccgtttccagcaagatgtttttatcgatttgttaggatatagaaaatatggg
cataacgaaggagatgagcctaaattcactcagccaaaattatattctattattgctaaa
catccgaatgttcgtgaaatatataaagacaaattgttgaaagaaggaacaatcggagaa
aatatcgtagcagaaaaagaaaaagaatacaaagatttgctggaagaaaaattcaacgaa
tcgaaaacaatcgagaaaaataccttagatgcttttatgccagaggtatggaaagattac
catattgctacaagagcagaagtattggcgaaagccgatacaactttcccgaaagagaaa
ttgaaagaaattgtcgatacgattgcagttgtaccagaaggtaaaaagcttatacgtaaa
gtttctcgtttaatagaggctcgagcaaaaggagttgccgaagacaagatcgattggggg
actgctgagttgatggcgtatggaagtgtgttgctcgaaggatatgatgttcgcttgtcg
ggtgaagacgtagagcgaggtactttctctcatcgccatgcagtcatcaaaacagaagac
acagaagaagaaattatacttcttaatgaaataagaaaagaacaaggagttttccgtgta
tacaattcgttgctatcagaatacggtgttcttggttttgattatgggtatgcaatggct
tacccgaaagggttaactctttgggaagcacagtttggtgactttgctaacggtgcccaa
attattatcgaccaatacatctcagctgctgaagacaaatggaaaatgcaaaatggtttg
gtaatgttattgcctcatgggtacgaaggtcaaggagcagagcattcatctgctcgtatg
gagcgtttcttacaactggcagcagaaaacaatatgtttattgtagacattacgacacct
gcaaactttttccatgcattgagaagacaggtagttaccaattatcgtaaaccattggtt
gtcttctcgccaaaatcactgttacgacatccagaagtagtttcaacgatggatgagatt
gcaaacggtgagttccaagaaattattgatgatgcaacagcagatccgaaaaaagtaact
aaattggttttctgtacaggtaagatttattacgaattgaagagctacagagaagagata
ggagatgataaaactgctctagttcgtatcgagcaactgtatcctatcgacgaagagaag
ttggaggctatcatcaaaaaatacaagaatcaaaaacaattaatctgggcacaagaagaa
ccagaaaatatgggtgcttgggggtatatcttacgcaagtttagaaaattacctttcgat
gttgtttgtcctgcagagagtggttcaccagcgccaggctcaagcaaaacatccgccatc
atacaacaagatacaatagaacgagtttttaaataa

DBGET integrated database retrieval system