KEGG   Xanthobacter autotrophicus: Xaut_2403Help
Entry
Xaut_2403         CDS       T00581                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00473  D-Alanine metabolism
xau01100  Metabolic pathways
xau01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Xaut_2403
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Xaut_2403
Enzymes [BR:xau01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Xaut_2403
Peptidoglycan biosynthesis and degradation proteins [BR:xau01011]
 Precursor biosynthesis
  Racemase
   Xaut_2403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABS67645
JGI: Xaut2403
UniProt: A7II02
LinkDB All DBs
Position
complement(2681787..2682860)
Genome map
AA seq 357 aa AA seqDB search
MDLGAIADNWRTIAALAAPAECAAVVKANAYGLGIDRVAPVLWRAGARNFFVAHFKEAVA
LRALLPEAIIYVLNGLLPDCAADYAAANLRPVLGSTPEISDWSDYCRDAGVKLPAAIHVD
TGMHRLGLSLEEAVQLSGTFRLLGFTPSLIMSHLACADTPGHVLTARQRMVFADVVRRFP
GIPGSLANSAGTLLGRDFRFELVRPGIFLYGGIAINGVPPLRPVVRLEVKVVQVSTAPAG
ETVGYGAAQRLKRPSRLATVSIGYADGLFRAGGSTDAIKGVEAIVHGQRCHLVGRVSMDL
ATLDITDLPDGVVQRGDTAVFLGDGISVDDLAARSGTIGYEVLTSLGARYARHYVGG
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
gtggatctgggcgccatcgccgacaactggcgcaccatcgcggcgcttgccgccccggcc
gaatgcgccgccgtggtcaaggccaacgcctacggcctcggcatcgaccgggtcgctccg
gtgctgtggcgggccggcgcgcgcaatttcttcgtcgcccatttcaaggaagcggtggcc
ctgcgcgccctgctgcccgaggccatcatctatgtgctgaacggccttctgccggattgc
gccgccgactatgcggccgcgaatctgcgcccggtgctgggatcgaccccggaaatctcc
gactggagcgactattgccgcgacgccggcgtcaagctgcccgccgccatccatgtggat
acgggcatgcaccggctcggcctgtcgctggaggaggcggtgcagctctccggcaccttc
cgcctgctgggcttcacccccagcctgatcatgagccatctcgcctgcgccgacacgccg
gggcacgtgctcaccgcccgccagcgcatggtgttcgccgacgtggtacgccgcttcccc
ggcattccgggatcgctggccaattcggccggcaccctgctcggccgcgacttccggttc
gagctggtgcggcctggcatcttcctctatggcggcatcgccatcaacggggtaccgccg
ttgcggccggtggtgcggctggaggtgaaggtggtgcaggtctccaccgccccggccggc
gagacggtgggctatggcgccgcccagcggctgaagcggccgagccggctcgccaccgtc
tccatcggctatgcggacggactgttccgcgccggcggctccaccgacgccatcaagggg
gtggaggccatcgtccacggccagcgctgccatctggtgggccgcgtctccatggacctc
gccacgctggacatcaccgacctgccggacggcgtggtgcaacggggcgacaccgccgtc
ttcctcggcgacggcatcagcgtggatgatcttgccgcccgctcgggcaccatcggctac
gaggtgctcacctcactgggcgcccgctacgcccgccattacgtgggcgggtaa

DBGET integrated database retrieval system