KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_0793Help
Entry
XACM_0793         CDS       T01616                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XACM_0793
Enzymes [BR:xax01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     XACM_0793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(909723..911081)
Genome map
AA seq 452 aa AA seqDB search
MVLLLTTANAQADVILHAFNWPYATVEARAKQIADAGYRKVLVAPAYRSEGSAWWARYQP
QDIRLIDNPLGDTAAFKKMVQALANNGVETYADIVFNHMANEAATRSDLNYPGSAVLSQY
AANPGRYDSLRLFGTLQSNFLSASDFGPAQCISNYNDAYQVRNYRICGGGSDPGLPDLVG
NDWVVQQQRAYLQALKSIGVTGFRVDAAKHMTFDHLNRVFDAGIRSGVYVFGEVITGGGT
GNGDYDQFLAPYLQSTPHAAYDFPLFNAVRNAFAIGASMQQLVDPAASGQALPGNRAVTF
AVTHDIPNNAGFRYAILDPVDETLAYAYLIGRNGGMPMIYTDNNESGDNRWVNAYLRDDL
RRMIGFHNGVQGTDMQVLSSSSCHILFRRGSLGIVGINKCGNPVTTTVGMNNSVLYWNAD
YVDALGSGNVVRISSSSYTFTLPARGARMWRR
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
ttggtcctgctgctgaccaccgccaacgcgcaggccgatgtcatcctgcatgccttcaac
tggccgtatgccaccgtcgaagcgcgcgccaagcagattgccgatgccggctatcgcaag
gtgttggtcgcccccgcgtaccgctccgaaggaagcgcgtggtgggcgcgctatcagccg
caggacattcgcctgatcgacaacccgctcggcgacaccgctgcgttcaagaagatggtc
caggcgctggccaacaacggcgtggaaacctatgccgacatcgtgttcaaccacatggcc
aacgaagcagccacgcgttcggatctcaactacccgggcagcgcggtgctgtcgcagtac
gctgcaaaccccggccgttacgattcgctgcgtctgttcggcacgctgcagtcaaacttc
ctcagcgccagcgatttcggcccggcgcaatgcatcagcaactacaacgacgcctaccag
gtgcgtaattaccgcatttgcggcggcggcagcgatccaggcctgccggatctcgtgggc
aacgactgggtggtgcagcaacaacgcgcctatctgcaagcgctcaagagcattggcgtg
accggcttccgggtggatgcggccaagcacatgaccttcgaccatctcaatcgcgtcttc
gatgccggcatccgctcgggtgtgtatgtcttcggtgaagtgatcaccggcggcggtaca
ggcaatggcgattacgaccagttcctggccccgtatctgcaatccacgccgcatgcagcc
tacgactttccgttgttcaatgcggtgcgcaatgcgttcgcgatcggcgccagcatgcag
cagctggtggaccccgccgcgtccggacaggcattgccgggcaatcgcgccgtgaccttt
gcagtgacccacgacattcccaacaacgccggcttccgctacgcaattctcgacccggtg
gatgagacgctggcctacgcatacctgatcggtcgcaacggcggcatgccgatgatctat
accgacaacaacgaaagcggcgacaaccgctgggtcaacgcctatctccgcgacgaccta
cgccgcatgatcggcttccataacggcgtgcagggcaccgacatgcaggtcttgtcgtcc
agctcctgccatatcctgttccgtcgcggcagcctaggcatcgtgggcatcaataagtgc
ggcaacccggtcaccaccacggtgggaatgaacaacagcgtgttgtactggaatgccgac
tacgtggacgcgttgggctcgggcaacgtggtgcgcatttccagcagctcgtacaccttt
accctgccggcgcgcggggcgcgcatgtggcgccgctga

DBGET integrated database retrieval system