KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_3392Help
Entry
XACM_3392         CDS       T01616                                 

Gene name
aspC
Definition
(GenBank) aminotransferase AlaT
  KO
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XACM_3392 (aspC)
   00290 Valine, leucine and isoleucine biosynthesis
    XACM_3392 (aspC)
   00220 Arginine biosynthesis
    XACM_3392 (aspC)
Enzymes [BR:xax01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     XACM_3392 (aspC)
    2.6.1.66  valine---pyruvate transaminase
     XACM_3392 (aspC)
Amino acid related enzymes [BR:xax01007]
 Aminotransferase (transaminase)
  Class I
   XACM_3392 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3943049..3944320
Genome map
AA seq 423 aa AA seqDB search
MSTAPQKPLAIRERLSEVRYEIRGELARRARELEAQGRKLIKLNIGNPGAFGFRAPEHLQ
RAIADDMGRTDPYTHQQGLPEAREAIAKAYSRRQHPDAHPDRIFVGNGVSELIDLSLRAL
LNPGDEVLVPSPDYPLWSAATILNDGRPVYYRCAPENGFQPDPVEIETLVSSRTRAIVLI
NPNNPSGASYSRELLERIVAIATKHNLLLMVDEIYDQVLYDDAAFVPVAPLAGAHPCITF
SGLSKVHRACGWRVGWALLSGDQARINDLRNAMDLLGALRLCANVPGQYAIDAAVNGPDT
ISALCAPGGRLYETRRAVIEACAASEHLQLVAPAGALYAFPAVVGAAARNFDDHAFALDL
MNEEGVLVVPGSSFNVPYRHHFRVTLMPEAGVMRDVFARIDRALARRAEAVTKVVPLKPR
SVA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgccccgcaaaagccgctcgccatccgcgagcgtctgtccgaagtccgctac
gagatccggggcgagctggcgcgacgagcgcgggagttggaggcgcagggacgcaagctg
atcaagctcaatatcggcaacccgggtgcattcgggttccgcgcgccggagcatctgcag
cgcgccatcgccgacgacatgggccgcaccgatccctacacccatcagcagggcctgccg
gaagcgcgcgaggcgatcgccaaggcgtattcgcgacgccagcaccccgatgcccatccg
gaccgtatctttgtcggtaacggggtcagcgagctgatcgacctgtcgctgcgcgccctg
ctcaaccccggcgatgaagtgctggtgccctcgcccgactacccgctgtggtcggcggcg
accatcctcaatgacggccgcccggtgtattaccgctgcgcgccggagaatggcttccag
ccggacccggtggagatcgaaacgctggtgtcctcgcgcacccgcgccatcgtgttgatc
aatcccaacaaccccagcggtgcgagctattcgcgcgagttgctggagcgcatcgtggcg
atcgccaccaagcacaatctgctgctgatggtcgatgagatctacgaccaggtgctgtac
gacgacgcggccttcgtgccggtcgcaccgctggccggtgcgcacccatgcatcaccttc
agcggcctgagcaaggtgcatcgcgcctgcggttggcgcgtgggctgggcgctgctgtcg
ggcgaccaagcgcgcatcaacgacctgcgcaatgcgatggacctgctcggcgcgctgcgc
ctgtgcgccaatgtgccaggccagtacgccatcgatgcggccgtgaacgggccggacacc
atctcggcgctgtgcgcgccgggcggccgcctgtatgaaacccgccgcgcggtgatcgag
gcctgtgcggccagcgagcatctgcagctggtggcaccggccggggcgctgtatgcgttc
ccggcggtggtgggcgcagcggcgcgcaacttcgacgatcatgcgttcgcactcgatctg
atgaacgaagaaggcgtgctggtggttcccggctccagcttcaacgtgccgtatcgccac
catttccgcgtgaccctgatgccggaagccggtgtgatgcgcgatgtgttcgcccgcatc
gaccgtgcattggcacgccgcgccgaagcggtcaccaaggtggttccactcaagccacgc
agcgtggcctga

DBGET integrated database retrieval system