KEGG   Xenorhabdus bovienii SS-2004: XBJ1_2494Help
Entry
XBJ1_2494         CDS       T01186                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase, iron
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
xbo  Xenorhabdus bovienii SS-2004
Brite
Enzymes [BR:xbo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     XBJ1_2494 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF1007
Motif
Other DBs
NCBI-ProteinID: CBJ81618
UniProt: D3V1S4
LinkDB All DBs
Position
2466917..2467495
Genome map
AA seq 192 aa AA seqDB search
MSFELPALPYAKNALEPHISAETLEYHYGKHHNAYVVNLNNLVKDTEFAGKSLEEIIKTS
EGGIFNNAAQVWNHTFYWNSLSPNGGGEPTGKVADAINSAFGSFTEFKQQFTDAALKNFG
SGWTWLVKKADGSVAIVNTSNAATPLTGKDKPVLTVDVWEHAYYIDYRNARPQYLEHFWA
LVNWKFVEENLA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgaattaccagcattaccttatgccaaaaatgccctggaaccacacatttca
gccgaaactctggaatatcattacggcaaacatcataacgcctacgttgtgaacctgaac
aatctggttaaagataccgaatttgccggaaaatcactggaagaaatcatcaaaacatcc
gaaggcggcatcttcaataacgcagcacaagtctggaatcacactttctactggaatagc
ctgtcaccaaacgggggtggtgaaccaactggaaaagttgcagacgctattaacagtgct
ttcggctcttttactgagttcaaacagcagtttactgatgctgcactgaaaaattttggt
tcgggttggacatggctggtcaagaaagctgatggtagcgtggctatcgtcaatacttcc
aatgccgcaactccattgactggtaaagataaacctgtactgacagttgatgtttgggaa
cacgcatattacatcgattaccgtaatgcgcgccctcaatatctggagcatttctgggct
ctggtcaactggaaatttgttgaagaaaatctggcttaa

DBGET integrated database retrieval system