KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_02080Help
Entry
XCAW_02080        CDS       T02519                                 

Gene name
cDC9
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:xci00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    XCAW_02080 (cDC9)
Enzymes [BR:xci01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     XCAW_02080 (cDC9)
DNA repair and recombination proteins [BR:xci03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     XCAW_02080 (cDC9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2295143..2297761)
Genome map
AA seq 872 aa AA seqDB search
MSLSEYRRKRSFDKTREPEPGKTLPPGQRAIFVVQLHHASRRHYDFRLQVGDALKSWAVP
KGPSYDPKVKRMAVEVEDHPVDYASFEGEIPRGEYGGGHVAQFDHGVWATAGDPEAQLAK
GHLRFELFGNKLKGGWHLVRSGKPARQPQWLLFKEDDAYAGTLEADDLLADVAATPADDV
RRAGAGKTQRKGLTTVPPPAAKKRGTWAKQALALSGARRAEMEDAPFAPQLAKLVQSPPE
GAQWLHEIKWDGYRILATVTNGKVRLWSRNALEWTDKTPEIADAIQSLGLRNAQIDGELI
AGRGTKEDFNLLQATLSGERQVPLALAVFDLLHVDGVDISEAPLRERKQLLQQVLQAAPH
MHLAYSSHVEGDGTEAFRVAGEQHFEGIISKRADRPYRDGRSDDWRKTKQLASQEYAVVG
YTAPKGSRSGFGSLLLATPDPVHGWLYVGRVGSGFSDALMREVTQQLEGGGRKPTAHIPT
PDTDLRGATWFAPRFVVEVFYRGIGGQQLLRQASFKALRPDKRIADLADSDAGNGRSTSS
STQRSAKTRAAKNAATQVAKRAATRATAPARKSAVATPSSAALPTLSSPTKLIYPDIRAT
KGDVWDYYQAVMDHLLPQIVGRPLSIIRCPSGAEKPCFFQKHHTAGLERVSSVKLTEETG
TNAYYLVIEDAPGLLELVQFNALEFHPWGSHADRPDVADRVVFDLDPGPDVPFAEVKRAA
NDIRKLLAQLELESFLRVSGGKGLHVVVPLNPGCDWEVTKRFAKGFADALAQAEPQRFIA
TATKRLRNKRIFVDYLRNGRGATAVASYSLRGRPGAPVALPLAWSDLSKLQRADAFTLRD
VPEKLRRRRKDPWADMDRIRQNLARWAEQDED
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgagcgaataccgccgcaagcgcagcttcgacaagacccgcgagccggagccg
ggcaagaccctgccgccggggcagcgtgcgatcttcgtggtgcagttgcaccacgccagc
cgccgccactacgattttcgcctgcaggtgggcgatgcgctcaagagctgggcggtgccg
aaggggccaagttacgaccccaaggtcaagcgcatggcagtggaggtggaagaccacccg
gtcgattacgccagcttcgagggcgagattcccaggggcgaatacggcggcgggcacgtg
gcgcagttcgatcatggcgtgtgggccaccgcaggcgaccccgaagcgcagttggccaag
gggcatctgcgcttcgagttgttcggcaacaagctcaagggcggctggcatctggtgcgc
tcgggcaagccggcgcggcagccgcagtggctgctgttcaaagaggacgatgcctacgct
ggcacgctggaggccgacgacctactggccgacgtcgctgccacacctgccgacgatgta
cgccgcgcgggcgccggcaagacccagcgcaaggggctgacgaccgtaccgccgccagcg
gcgaaaaaacgtggcacctgggcgaaacaggcgctggcgctgagcggcgcacgtcgcgcc
gagatggaagatgccccgtttgcgccgcagctggccaagctggtgcagtccccgcccgaa
ggcgcgcagtggctgcatgaaatcaaatgggacggttatcgcatcctggccacggtgacc
aatggcaaggtgcggctgtggtcgcgcaatgcattggagtggaccgacaagacaccggaa
attgccgatgccatccagtcgctgggcctgcgcaatgcgcagatcgatggcgaattgatc
gccggacgcggcaccaaggaagacttcaacctgctgcaggccaccttgtccggcgaacgc
caggtgccgctggcgctggcggtattcgacctgctgcatgtggacggggtggacattagt
gaggcaccgttgcgcgagcgcaagcagctgttgcagcaggtgctgcaggctgcaccccac
atgcatctggcctatagctcgcatgtcgagggcgacggcaccgaggcgttccgggtggcc
ggcgaacagcacttcgaaggcatcatttccaaacgcgcagatcgcccgtatcgcgatggg
cgcagcgacgattggcgcaagaccaagcaactggccagccaggaatatgcggtggtcggc
tacaccgcgcccaagggcagccgcagtggttttggctcgctgttgctggccacgccggac
ccggtgcacggctggttatacgtgggccgtgtgggctcaggtttctccgatgccttgatg
cgcgaggtcacccagcaactggaaggcggtgggcgcaaacccaccgcgcatattcccacc
ccagacaccgacctgcgcggcgccacctggtttgcgccgcgctttgtggtggaggtgttc
tatcgcggcatcggtgggcaacagttattgcgccaggcatcgttcaaggcgctgcgtccg
gataaacgcattgccgatctggccgacagcgatgccggaaatggccggtctacttcgtcg
tctacccagcgttcggcaaaaacacgtgctgccaaaaacgcggcaacccaggtagcgaaa
cgtgcagcgacgcgggcaacagcgcctgcgcgcaaatctgcggttgccacaccttcctcg
gctgcgctgccgacgctgtccagcccgaccaagctgatctacccggatatccgcgcgacc
aagggcgatgtctgggactactaccaggcggtgatggatcacctgttgccgcagatcgtg
ggacgcccgctgtccatcattcgctgccccagcggcgccgaaaaaccgtgtttcttccag
aagcaccacaccgccggcctcgagcgtgtgagctcggtcaaactgaccgaagagaccggc
accaatgcgtattacctggtgatcgaagacgcacccggcctgctggagctggtgcaattc
aatgcgctggaattccatccctggggctcgcatgccgaccgcccggatgtggccgaccgg
gtggtcttcgatctcgacccgggcccggacgtgccgttcgccgaggtcaaacgtgcggcc
aacgatattcgtaagctgctggcgcaattggagctggagtcgttcctgcgtgtgtctggc
ggcaaggggctgcacgtggtggtgcccctgaatcccggctgcgactgggaggtgaccaag
cgtttcgccaagggattcgccgatgccctggcgcaggccgagccgcagcggttcatcgcc
actgccaccaagcggctgcgcaacaagcgcatcttcgtggactacctgcgcaacggccgt
ggcgccacggcggtcgcgtcctattcgttacgcggccgcccgggggcgccagtcgcgctg
ccgctggcgtggtcggacctgtccaagctgcagcgcgccgatgcattcaccttgcgcgat
gtgccggaaaagctgcgccgtcggcgcaaggacccctgggcagacatggaccgcattcgg
cagaacctggcgcgctgggcggagcaggacgaggactga

DBGET integrated database retrieval system