KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_03774Help
Entry
XCAW_03774        CDS       T02519                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:xci00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    XCAW_03774 (ppc)
  Energy metabolism
   00680 Methane metabolism
    XCAW_03774 (ppc)
Enzymes [BR:xci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     XCAW_03774 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(4207781..4210495)
Genome map
AA seq 904 aa AA seqDB search
MNEYRSSLVFATPDLPLRDDVRRLGALVGDLLAEQVSAEFLDEIERVRTTAISRRESDAP
PSTLSEQLAGRQPRDAEALVRAFSTYFQVVNIAERVHRIRRRREYQRSGTDTPQPDGLHD
ALRRLKAQGVTLDELSQWLPRIDVEPVFTAHPTEAVRRALLEKEQLMVASLVDNLDGMRT
PNERASDAARFRMALTASWQTADSSPVRPTVDDEREHVGFYLTQVLYRVIPVMYETLEHA
IEETYGSVPALPRLLRFGTWVGGDMDGNPNVDAKTIAGTLDAQRRAVLDRYQKELWQLAS
LLSQSTTLVQVSGELTAQLERYRALLPDAAARSRPRHGDMPYRLLNDLMRARLQATLDDA
DGAYAAPSELEHDLQLILDSLQANKGLHAGWFAARRLLWRVRSFGFHLARLDVRQESSVH
ARAVADALGQTDWDAQDATQRAAVLGPYAAGQDPLPRVDDEGNARLDAVFAALADARTRH
GADALGSYIISMAHNRADVLTVLALARRGGLVDDAGAVPLDIVPLFETVDDLRGGTGTVQ
DLLADPVYRQHLAARGDTQMVMLGYSDSGKDGGIAASRWGLQRAQVELLEAAAELGVRLT
FFHGRGGSIARGGGKTSRALDAAPRGSVDGRLRVTEQGEVIHRKYGIRALALRSLEQMTG
AVLLSSLRPRAPEPREARWRPVMDLVAERSTVAYRAFVGAPEFMQYFRLATPIDVIERMT
LGSRPSRRLGQDAALSNLRAIPWVFAWSQARAVIPGWYGVGSGLQAAVDAGHEETLREMA
QDWPFFRTFLDDIAMVLSKGDLNIAELFSRLSGDLHTRFFPLIRDELALTKGWVKALLQQ
QSLLQHDPRLALSIRLRNPYIDPISVLQVDLLQRWRATDGEDEALLRALVACVNGVSQGV
QNTG
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagtaccgcagcagtcttgtgttcgcgacccccgatcttcccttgcgcgacgat
gtgcgtcggctcggcgcgctggtgggtgatctgctcgccgagcaggtctctgcggaattc
ctcgatgaaatcgaacgcgtgcgcaccaccgccatctcgcggcgcgaaagcgatgcccca
ccgtccacgctgagcgaacaactcgccggtcggcagccgcgtgacgccgaagcgctggtc
cgggcattcagtacctatttccaggtggtcaatatcgccgagcgcgtgcaccgcatccgc
cgccgtcgcgaatatcagcgcagcggcaccgacacgccgcagcccgatggcctgcatgac
gcattgcgccggctcaaggcgcagggcgtgaccctggacgaactcagccaatggttgccg
cgcatcgacgtggagccggtgttcaccgcgcatcccaccgaggcggtacggcgcgcgctg
ctggaaaaagagcagctgatggtcgccagcctggtcgacaacctggacggcatgcgcacg
cccaacgagcgtgccagcgatgccgcgcgcttccgcatggccttgaccgcgtcgtggcag
accgccgattcctcgccggtgcgccccaccgtggacgacgagcgcgagcatgtgggcttc
tacctcacccaggtgctctaccgcgtcatcccggtgatgtacgaaacgctcgaacacgcc
atcgaagaaacctacggcagcgtgccggcattgccgcgtctgctgcgcttcggcacctgg
gtgggcggcgacatggacggcaatcccaacgtggatgccaagaccatcgccgggacgctg
gacgcgcagcggcgcgcggtgctggaccgttatcaaaaagaactctggcagttggccagc
ctgctcagccaatcgaccacgctggtacaggtgagcggcgaactcaccgcgcagctggaa
cgctaccgcgcgctgctccccgacgccgccgcgcgttcgcgcccgcgccatggcgacatg
ccgtaccgcctgctcaacgacctgatgcgcgcgcgcctgcaggccaccctggacgatgcc
gatggcgcctatgccgctccatcggagctcgaacacgatctgcagctgatcctggacagc
ctgcaggccaacaagggcctgcatgccggttggttcgcggcacggcgcctgttgtggcgc
gtgcgtagctttggtttccatctggcgcggctggacgtgcgccaggaatcgagcgtgcat
gcgcgcgcagtggccgatgccctgggccagaccgactgggacgcacaggacgccacccag
cgcgccgccgtgctcggcccgtatgccgcagggcaagaccccttgccgcgcgtggacgat
gaaggcaatgcacggttggatgcggtattcgccgcgcttgccgatgcacgtacccgccac
ggcgccgatgcattgggcagctacatcatctcgatggcgcataaccgcgccgacgtgttg
actgtgctggcactggcgcggcgtggcggcctggtcgacgacgccggcgctgtgccgctg
gatatcgtgccgctgttcgaaaccgtggacgatctgcgcggcggtaccggcaccgtgcag
gacctgctggccgacccggtctatcgccagcatctggccgcacgcggcgatacccagatg
gtgatgctgggctattcggacagcggcaaggacggcggcatcgccgcctcgcgctggggc
ctgcaacgcgcgcaggtcgagctgctggaagcggccgccgagttgggcgtgcggctgacc
ttcttccacggccgaggcggctcgatcgcgcgcggcggcggcaagaccagccgcgcgctg
gatgccgcaccgcgcggcagcgtggatgggcgcctgcgcgttaccgagcagggcgaggtg
atccaccgcaaatatggcatccgcgcattggcgttgcgctcgctggagcagatgaccggc
gcggtgctgctctcgagcctgcgcccgcgtgcgcccgagccgcgcgaggcgcgttggcgc
ccggtgatggatctggtggccgaacgcagcacggtcgcgtatcgcgccttcgtcggcgcg
ccggagttcatgcagtacttccgcctggccacgccgatcgatgtgatcgaacgcatgacg
ctgggttcgcgcccgtcgcggcggctgggccaggacgcggcgctgtccaacctgcgtgcg
attccgtgggtgtttgcgtggagccaggcgcgtgcggtgattcccggctggtacggcgtg
ggcagcggcctgcaggcggcggtggatgccgggcatgaagagaccttgcgcgaaatggcg
caggactggccgttcttccgcacctttctggacgacatcgccatggtgttgtccaagggc
gatctgaacatcgccgagttgttctcgcgcttgtccggcgacctgcacacgcggtttttc
ccgctgattcgcgacgaactggcattgaccaagggctgggtgaaggcgctgctgcaacaa
cagtcgctgttgcagcacgacccgcggctggcgttgtcgatccgcctgcgcaatccctac
atcgacccgatcagcgtgctgcaggtggatctgctgcaacgctggcgcgccaccgatggc
gaagacgaagcgctgctgcgcgcgctggtggcctgcgtcaatggcgtctcgcaaggcgtg
cagaacaccggctga

DBGET integrated database retrieval system