KEGG   Xanthomonas citri subsp. citri NT17: J169_00929Help
Entry
J169_00929        CDS       T03734                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
xcn  Xanthomonas citri subsp. citri NT17
Pathway
xcn00620  Pyruvate metabolism
xcn00680  Methane metabolism
xcn01100  Metabolic pathways
xcn01120  Microbial metabolism in diverse environments
xcn01200  Carbon metabolism
Module
xcn_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:xcn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    J169_00929
  Energy metabolism
   00680 Methane metabolism
    J169_00929
Enzymes [BR:xcn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     J169_00929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AJY89778
UniProt: A0A0U5BNQ0
LinkDB All DBs
Position
958445..961159
Genome map
AA seq 904 aa AA seqDB search
MNEYRSSLVFATPDLPLRDDVRRLGALVGDLLAEQVSAEFLDEIERVRTTAISRRESDAP
PSTLSEQLAGRQPRDAEALVRAFSTYFQVVNIAERVHRIRRRREYQRSGTDTPQPDGLHD
ALRRLKAQGVTLDELSQWLPRIDVEPVFTAHPTEAVRRALLEKEQLMVASLVDNLDGMRT
PNERASDAARFRMALTASWQTADSSPVRPTVDDEREHVGFYLTQVLYRVIPVMYETLEHA
IEETYGSVPALPRLLRFGTWVGGDMDGNPNVDAKTIAGTLDAQRRAVLDRYQKELWQLAS
LLSQSTTLVQVSGELTAQLERYRALLPDAAARSRPRHGDMPYRLLNDLMRARLQATLDDA
DGAYAAPSELEHDLQLILDSLQANKGLHAGWFAARRLLWRVRSFGFHLARLDVRQESSVH
ARAVADALGQTDWDAQDATQRAAVLGPYAAGQDPLPRVDDEGNARLDAVFAALADARTRH
GADALGSYIISMAHNRADVLTVLALARRGGLVDDAGAVPLDIVPLFETVDDLRGGTGTVQ
DLLADPVYRQHLAARGDTQMVMLGYSDSGKDGGIAASRWGLQRAQVELLEAAAELGVRLT
FFHGRGGSIARGGGKTSRALDAAPRGSVDGRLRVTEQGEVIHRKYGIRALALRSLEQMTG
AVLLSSLRPRAPEPREARWRPVMDLVAERSTVAYRAFVGAPEFMQYFRLATPIDVIERMT
LGSRPSRRLGQDAALSNLRAIPWVFAWSQARAVIPGWYGVGSGLQAAVDAGHEETLREMA
QDWPFFRTFLDDIAMVLSKGDLNIAELFSRLSGDLHTRFFPLIRDELALTKGWVKALLQQ
QSLLQHDPRLALSIRLRNPYIDPISVLQVDLLQRWRATDGEDEALLRALVACVNGVSQGV
QNTG
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagtaccgcagcagtcttgtgttcgcgacccccgatcttcccttgcgcgacgat
gtgcgtcggctcggcgcgctggtgggtgatctgctcgccgagcaggtctctgcggaattc
ctcgatgaaatcgaacgcgtgcgcaccaccgccatctcgcggcgcgaaagcgatgcccca
ccgtccacgctgagcgaacaactcgccggtcggcagccgcgtgacgccgaagcgctggtc
cgggcattcagtacctatttccaggtggtcaatatcgccgagcgcgtgcaccgcatccgc
cgccgtcgcgaatatcagcgcagcggcaccgacacgccgcagcccgatggcctgcatgac
gcattgcgccggctcaaggcgcagggcgtgaccctggacgaactcagccaatggttgccg
cgcatcgacgtggagccggtgttcaccgcgcatcccaccgaggcggtacggcgcgcgctg
ctggaaaaagagcagctgatggtcgccagcctggtcgacaacctggacggcatgcgcacg
cccaacgagcgtgccagcgatgccgcgcgcttccgcatggccttgaccgcgtcgtggcag
accgccgattcctcgccggtgcgccccaccgtggacgacgagcgcgagcatgtgggcttc
tacctcacccaggtgctctaccgcgtcatcccggtgatgtacgaaacgctcgaacacgcc
atcgaagaaacctacggcagcgtgccggcattgccgcgtctgctgcgcttcggcacctgg
gtgggcggcgacatggacggcaatcccaacgtggatgccaagaccatcgccgggacgctg
gacgcgcagcggcgcgcggtgctggaccgttatcaaaaagaactctggcagttggccagc
ctgctcagccaatcgaccacgctggtacaggtgagcggcgaactcaccgcgcagctggaa
cgctaccgcgcgctgctccccgacgccgccgcgcgttcgcgcccgcgccatggcgacatg
ccgtaccgcctgctcaacgacctgatgcgcgcgcgcctgcaggccaccctggacgatgcc
gatggcgcctatgccgctccatcggagctcgaacacgatctgcagctgatcctggacagc
ctgcaggccaacaagggcctgcatgccggttggttcgcggcacggcgcctgttgtggcgc
gtgcgtagctttggtttccatctggcgcggctggacgtgcgccaggaatcgagcgtgcat
gcgcgcgcagtggccgatgccctgggccagaccgactgggacgcacaggacgccacccag
cgcgccgccgtgctcggcccgtatgccgcagggcaagaccccttgccgcgcgtggacgat
gaaggcaatgcacggttggatgcggtattcgccgcgcttgccgatgcacgtacccgccac
ggcgccgatgcattgggcagctacatcatctcgatggcgcataaccgcgccgacgtgttg
actgtgctggcactggcgcggcgtggcggcctggtcgacgacgccggcgctgtgccgctg
gatatcgtgccgctgttcgaaaccgtggacgatctgcgcggcggtaccggcaccgtgcag
gacctgctggccgacccggtctatcgccagcatctggccgcacgcggcgatacccagatg
gtgatgctgggctattcggacagcggcaaggacggcggcatcgccgcctcgcgctggggc
ctgcaacgcgcgcaggtcgagctgctggaagcggccgccgagttgggcgtgcggctgacc
ttcttccacggccgaggcggctcgatcgcgcgcggcggcggcaagaccagccgcgcgctg
gatgccgcaccgcgcggcagcgtggatgggcgcctgcgcgttaccgagcagggcgaggtg
atccaccgcaaatatggcatccgcgcattggcgttgcgctcgctggagcagatgaccggc
gcggtgctgctctcgagcctgcgcccgcgtgcgcccgagccgcgcgaggcgcgttggcgc
ccggtgatggatctggtggccgaacgcagcacggtcgcgtatcgcgccttcgtcggcgcg
ccggagttcatgcagtacttccgcctggccacgccgatcgatgtgatcgaacgcatgacg
ctgggttcgcgcccgtcgcggcggctgggccaggacgcggcgctgtccaacctgcgtgcg
attccgtgggtgtttgcgtggagccaggcgcgtgcggtgattcccggctggtacggcgtg
ggcagcggcctgcaggcggcggtggatgccgggcatgaagagaccttgcgcgaaatggcg
caggactggccgttcttccgcacctttctggacgacatcgccatggtgttgtccaagggc
gatctgaacatcgccgagttgttctcgcgcttgtccggcgacctgcacacgcggtttttc
ccgctgattcgcgacgaactggcattgaccaagggctgggtgaaggcgctgctgcaacaa
cagtcgctgttgcagcacgacccgcggctggcgttgtcgatccgcctgcgcaatccctac
atcgacccgatcagcgtgctgcaggtggatctgctgcaacgctggcgcgccaccgatggc
gaagacgaagcgctgctgcgcgcgctggtggcctgcgtcaatggcgtctcgcaaggcgtg
cagaacaccggctga

DBGET integrated database retrieval system