KEGG   Xanthomonas campestris pv. raphani: XCR_1338Help
Entry
XCR_1338          CDS       T01872                                 

Definition
(GenBank) Dipeptidyl carboxypeptidase I
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
xcp  Xanthomonas campestris pv. raphani
Brite
Enzymes [BR:xcp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     XCR_1338
Peptidases [BR:xcp01002]
 Metallo Peptidases
  Family M2
   XCR_1338
Exosome [BR:xcp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XCR_1338
CD molecules [BR:xcp04090]
 Proteins
  XCR_1338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1367151..1369169)
Genome map
AA seq 672 aa AA seqDB search
MNPRLLLLALAVAAGTLSLSSCRQDAAPTPKPATTKTAPSESADQFVARISAEYKAAYPE
MTAAQWLSSTYINGDSQLLAAKANERALSQLDRWIDQSKQYAGTPMSADSARALQLLKLM
SALPAPRDPAKLAELTRIAAKMEGDYGAGSACTGDGEQRRCRQLGELEQVLARSRDYDEQ
LQAWQGWHATAQPMRKDYQRFVELANDGARGMGFADVGAMWRSGYDMPPAQLASETDRLW
EQLKPLYTQLQCYARGKLDTQYGKDKGEVAGGMLPAHLMGNMWQQDWSNLWDLLQPYPGA
GDLDITSALEKQYQGNLSAALARNTGGDGGAAARFLAERDAQLRTAQQMTERAQDFYTSL
GMPKLPDTYWQRSQFIKPLDRDVVCHASAWDMNMGGEPNAGIGPDVRTKMCIRPTEEDFT
TIYHELGHIYYDMAYNPLPPLFQNGANDGFHEAIGDTIVLAMTPKYLQSISMVGEQQSGR
EALINSQMRMALSKVAFLPFGLMIDRWRWGVFDGSIPPERYNQAWWELKATYQGVAPVSP
RGEDFFDAGAKYHVPGNTPYTRYFLAHILQFQFYKGLCDAAGHQGPLYECSFYGNKEAGQ
KFWSMLQRGSSQPWQTTLKEVTGKDTLDAGPMLEYFAPMQEWLKQQNQGQMCGWQAKGAT
ATPPATPAPSTR
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcctcgtctgctgttgctggcgctcgccgttgccgccggtacgttgtcgctgtcg
tcgtgccgccaggatgcggcgccgacgcccaagcccgccaccaccaagaccgcacccagc
gaaagcgccgaccagttcgtggcgcgcatcagtgccgagtacaaggcggcgtatccggaa
atgactgccgcgcagtggctgtcgtcgacctacatcaacggcgactcgcagttgctggcg
gccaaggccaacgagcgcgcgctgagccagctggatcgctggatcgaccaatccaagcag
tacgccggcacgccgatgtccgccgacagcgcgcgtgcgctgcaattactcaaactgatg
agcgccctgcccgccccgcgcgacccggccaagctggccgaactcacgcgtatcgcggcg
aagatggaaggcgactacggcgcgggcagcgcctgcaccggtgacggcgaacaacgccgt
tgccgccagctgggcgagctcgaacaagtgctggcacgcagccgcgactacgacgaacaa
ctgcaggcctggcagggctggcacgccaccgcgcaaccaatgcgcaaggactaccagcgc
tttgtcgagctcgccaacgacggtgcacgcggcatgggctttgccgatgtcggtgcgatg
tggcgcagcggctacgacatgccgccggcgcaactggccagcgaaaccgaccgcctgtgg
gaacagctcaaaccgctgtacacccagctgcagtgctacgcgcgcggcaagctggatacg
cagtacggcaaggacaagggcgaggtggccggcggcatgctgcccgcgcacctgatgggc
aacatgtggcagcaggactggagcaacctgtgggatctgctgcagccctatccgggtgcg
ggcgacctggacatcacctcggcactggaaaaacagtaccagggcaacctgagcgccgcg
ctggcacgcaataccggtggcgatggcggcgcagccgcacgcttcctcgccgagcgcgac
gcgcaactgcgcactgcccagcagatgaccgaacgcgcgcaggatttctacacgtcgctg
ggcatgccgaagttgccggacacctattggcaacgctcgcagttcatcaagccactggac
cgcgacgtggtctgccacgccagcgcgtgggacatgaacatgggcggcgagccgaacgcg
ggcatcggcccggacgtgcgcaccaagatgtgcatccgccccactgaagaagacttcacc
accatctaccatgagcttggccacatctattacgacatggcctacaacccgttgccgccg
ctgttccagaacggcgccaacgacggcttccacgaagccatcggcgacaccatcgtgctg
gcgatgacccccaagtacctgcagtcgatcagcatggtcggcgagcagcagagcgggcgc
gaggcattgatcaattcgcagatgcgcatggccttgagcaaggtggcgtttctgccgttc
gggttgatgatcgaccgctggcgctggggcgtattcgacggctcgatcccgccggagcgc
tacaaccaggcctggtgggagttgaaggccacctaccagggcgtggcaccggtgagcccg
cgcggcgaggacttcttcgatgccggcgccaaataccacgtgcccggcaacacgccctac
acccgttattttctcgcgcacatcctgcaattccagttctacaagggcctgtgcgatgcc
gccggccaccagggcccgttgtacgaatgcagcttctacggcaacaaggaagccggccag
aaattctggtcgatgctgcaacgtggctccagccaaccctggcagaccacgctgaaggaa
gtgaccggcaaggacaccctcgatgccggcccgatgctggaatatttcgcgccgatgcag
gaatggctcaaacaacagaaccagggccagatgtgcgggtggcaggccaagggcgccact
gcaacgccgccggcaacgccggcgccttcgacgcgctga

DBGET integrated database retrieval system