KEGG   Xanthomonas campestris pv. vesicatoria: XCV1249Help
Entry
XCV1249           CDS       T00288                                 

Definition
(GenBank) putative peptidyl dipeptidase precursor
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Brite
Enzymes [BR:xcv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     XCV1249
Peptidases [BR:xcv01002]
 Metallo Peptidases
  Family M2
   XCV1249
Exosome [BR:xcv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XCV1249
CD molecules [BR:xcv04090]
 Proteins
  XCV1249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1407056..1409074)
Genome map
AA seq 672 aa AA seqDB search
MNPRLLLLALAVAAGTLSLSACRRDAAPPDTPVASKTALAESADQFVARISAEYKAAYPE
ITAAQWLSSTYINGDSQLLAAKANERSLAQLDRWIEQSKQYAGTPMSADSARALQLLKLM
SALPAPRDPAKLAELTRIAAKMEGDYGAGSYCVGEGEQRRCRQLGELEQVLASSRDYNEQ
LDAWQGWHSTAQPMRKDYQRFVELANEGARGLGFADVGVLWRSGYDMPPAQLASETDRLW
EQVKPLYAQLQCYARGKLDTQYGKDKGEVAGGLLPAHLMGNMWQQDWSNLWDLLQPYPGA
GDLDITSALEKQYQGNLSAVLARNTGGDGGAAARFNAEREAQLRTAKQMTERAQDFYTSL
GMPKLPDTYWQRSQFIKPLDRDVVCHASAWDMNMGGEPNQNIGADVRTKMCIKPTEEDFT
TIYHELGHIYYDLAYNPLPPLFQNGANDGFHEAIGDTIVLAMTPKYLQSIGMVGEQQTGR
ESLINSQMRMALSKVAFLPFGLMIDRWRWGVFDGSITPEHYNQAWWELKAKYQGVAPVGA
RGEEFFDPGAKYHVPGNTPYTRYFLAHILQFQFYKGLCQAAGHQGPLYECSFYGNKDAGQ
KFWSMLQRGSSQPWQTTLKELTGNDKLDAGPMLEYFAPMSEWLKQQNQGQMCGWQAPAAT
PATTTTAPAMAR
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcctcgtttgctgttgctggcgttggctgtggctgccggcaccctgagcttgtcg
gcctgccgccgggatgcggcaccaccggacacacctgtggcgagcaagaccgcgctggcc
gaaagcgccgaccagttcgttgcgcgcatcagcgccgaatacaaggcggcctatccggaa
atcactgcggcgcagtggctgtcgtcgacctacatcaacggcgattcgcagttgctggcg
gccaaggccaacgaacgctcgctggcgcagctggaccggtggatcgaacaatccaagcag
tacgccggcacaccgatgtcggccgacagtgcgcgtgcgctgcaattgctgaaattgatg
agtgccctgcccgcaccgcgcgacccggccaagctggccgaactcacccgcatcgccgcc
aagatggaaggcgattacggcgcgggcagctactgcgtgggcgaaggcgagcagcgccgc
tgccgccagctcggcgagttggagcaagtgctggccagcagccgcgactacaacgaacaa
ctcgacgcctggcagggctggcacagcactgcgcagcccatgcgcaaggactaccaacgc
ttcgtcgaactggccaacgagggcgcacgcgggctgggtttcgccgacgtcggggtgcta
tggcgcagcggctacgacatgccgccggcgcaactggccagcgaaaccgaccgtctgtgg
gaacaggtcaaaccgttgtatgcgcagctgcagtgctatgcgcgcggcaaactcgatacg
caatacggcaaggacaagggcgaggtcgccggcggcctgttgccggcacacctgatgggc
aatatgtggcagcaggactggagcaacctgtgggatctgctgcagccctaccctggcgcc
ggtgatctggacatcacctccgcgctggaaaagcagtaccagggcaacctcagcgcagtg
ctggcgcgcaataccggcggcgatggtggcgcggccgcacgcttcaacgccgaacgcgag
gcgcagctgcgtaccgccaagcagatgaccgaacgcgcgcaggatttctacacatcgctg
ggcatgcccaagctgccggacacgtattggcagcgctcgcagttcatcaagccgctggac
cgcgatgtggtgtgccacgccagcgcctgggacatgaacatgggcggcgagccgaaccag
aacatcggcgcggacgtgcgcaccaagatgtgcatcaagccgaccgaagaagacttcacc
accatctaccacgagctgggccacatctattacgacctggcttataacccgttgccgccg
ctgtttcagaacggcgccaacgatggcttccacgaagcgatcggcgacaccatcgtgctg
gcgatgacgcccaagtacctgcagtcgatcggcatggtgggcgagcaacagaccggccgc
gagtcgttgatcaattcgcagatgcgcatggcactgagcaaggtggcgttcctgccgttc
ggtttgatgatcgaccgctggcgctggggcgtgttcgacggctccatcacgcccgagcat
tacaaccaggcctggtgggaactgaaagccaagtaccagggcgtggcgccggtcggcgcg
cgcggcgaagaattcttcgaccctggcgccaagtaccacgtgccgggcaacacgccgtac
acgcgctatttcctggcgcatatcctgcaattccaattctacaaaggcctatgccaggct
gccggccatcaggggccgctgtacgaatgcagcttctacggcaacaaggacgccgggcag
aagttctggtcgatgctgcagcgtggttccagccaaccctggcagaccacactcaaggaa
ctcaccggcaacgacaaactcgatgccggaccgatgctggaatacttcgcgccgatgagc
gaatggctcaagcagcagaatcaagggcagatgtgcgggtggcaggcaccggccgccact
ccggcaaccacgacgactgcgcctgcgatggcgcgctga

DBGET integrated database retrieval system