KEGG   Xanthomonas fuscans: XFF4834R_chr33230Help
Entry
XFF4834R_chr33230 CDS       T03094                                 

Definition
(GenBank) Putative peptidyl dipeptidase precursor
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
xfu  Xanthomonas fuscans
Brite
Enzymes [BR:xfu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     XFF4834R_chr33230
Peptidases [BR:xfu01002]
 Metallo Peptidases
  Family M2
   XFF4834R_chr33230
Exosome [BR:xfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XFF4834R_chr33230
CD molecules [BR:xfu04090]
 Proteins
  XFF4834R_chr33230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3819521..3821539
Genome map
AA seq 672 aa AA seqDB search
MNPRLLLLALAVAAGTLSLSACRRDAAPPDKPVATKTAPAESADQFVARISAEYKAAYPE
TTAAQWLSSTYINGDSQLLAAKANERSLAQLDRWIEQSKQYAGTPMSADSARALQLLKLM
SALPAPRDPAKLAELTRIAAKMEGDYGAGSYCVGEGEQRRCRQLGELEQVLASSRDYNEQ
LDAWQGWHSTAQPMRKDYQRFVELANEGARGLGFADVGVLWRSGYDMPPAQLASETDRLW
EQVKPLYAQLQCYARGKLDTQYGKDKGEVAGGLLPAHLMGNMWQQDWSNLWDLLQPYPGA
GDLDITSALEKQYQGNLTAVLARNAGGDGGAAARFNAEREAQLRTAKQMTERAQDFYTSL
GMPKLPDTYWQRSQFIKPLDRDVVCHASAWDMNMGGEANQNIGADVRTKMCIKPTEEDFT
TIYHELGHIYYDLAYNPLPPLFQNGANDGFHEAIGDTIVLAMTPKYLQSIGMVGEQQTGR
ESLINSQMRMALSKVAFLPFGLMIDRWRWGVFDGSITPEHYNQAWWELKAKYQGVAPVSA
RGEEFFDPGAKYHVPGNTPYTRYFLAHILQFQFYKGLCQAAGHQGPLYECSFYGNKDAGQ
KFWSMLQRGSSQPWQTTLKELTGNDKLDAGPMLEYFAPMSDWLKQQNQGQMCGWQATAAT
PATTKTAPAAAR
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcctcgtttgctgttgctggcgttggccgtggctgccggcaccctgagcttgtcg
gcctgccgccgggatgcggcaccaccggacaaacctgtcgcgaccaagaccgcgccggcc
gaaagcgccgaccagttcgttgcgcgcatcagcgccgaatacaaggcggcctatccggaa
accaccgctgcgcagtggctgtcgtcgacctatatcaacggcgattcgcagttgctggcg
gccaaggccaacgaacgctcgctggcgcagctggatcggtggatcgaacaatccaagcag
tacgccggcacaccgatgtcggccgacagtgcgcgtgcgctgcagttgctcaaattgatg
agtgccctgcccgcaccgcgcgacccggccaagctggccgaactcacccgcatcgccgcc
aagatggaaggcgattacggcgccggcagctactgcgtgggcgaaggcgagcagcgccgc
tgccgccagctcggcgagttggagcaagtgctggccagcagccgcgactacaacgagcaa
ctcgacgcctggcagggctggcacagcactgcgcaacccatgcgcaaggactaccaacgc
ttcgtcgagctggccaatgagggcgcacgcgggctgggtttcgccgacgtcggggtgcta
tggcgcagcggctacgacatgccgccggcgcaactggccagcgaaaccgaccgcctatgg
gaacaggtcaaaccgttgtatgcgcagttgcagtgctatgcgcgcggcaaactcgacacg
caatacggcaaagacaagggcgaggtcgccggcggcctgttgccggcacatctgatgggc
aatatgtggcagcaggactggagcaatctatgggatctgctgcagccctacccgggggcc
ggcgatctggacatcacctccgcgctggaaaagcagtaccagggcaacctcaccgcagtg
ctggcacgcaacgccggtggcgatggtggcgcggccgcacgcttcaacgccgaacgcgaa
gcgcagctgcgcaccgccaagcagatgaccgaacgcgcgcaggatttctacacatcgctg
ggcatgcccaagctgccggacacctattggcagcgctcgcagttcatcaagccgctggac
cgcgacgtggtgtgccacgccagcgcctgggacatgaacatgggcggcgaggcgaaccag
aacatcggcgcggatgtgcgcaccaagatgtgcatcaaaccgaccgaagaagacttcacc
accatctaccacgagctgggccacatctattacgacctggcctacaacccgttaccgccg
ctgttccagaatggcgccaacgacggcttccacgaagcgatcggcgacaccatcgtgctg
gcgatgacgcccaaatacctgcaatcgatcggcatggtgggcgaacaacagaccggccgc
gagtcgttgatcaattcgcagatgcgcatggcgctgagcaaggtggcgttcctgccgttc
ggtttgatgatcgaccgctggcgctggggcgtgttcgacggctccatcacgcccgagcat
tacaaccaggcctggtgggaactcaaagccaagtaccagggcgtggcgccggtcagcgcg
cgcggcgaagaattcttcgaccctggcgccaagtaccacgtgccgggcaacacgccgtac
acgcgctattttctggcgcatatcctgcaattccagttctacaaaggcctgtgccaggcc
gccggccatcaggggccgctgtacgaatgcagcttctacggcaacaaggacgccgggcag
aagttctggtcgatgctgcagcgtggttccagccaaccctggcagaccacgctcaaggaa
ctcaccggcaacgacaaactcgatgccggcccgatgctggaatacttcgcgccgatgagc
gactggctgaagcagcagaatcaggggcagatgtgcgggtggcaggcaacggctgccact
ccggctacaacgaagactgcgcctgctgcagctcgttga

DBGET integrated database retrieval system