KEGG   Xanthomonas gardneri: BI317_04880Help
Entry
BI317_04880       CDS       T04668                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
xga  Xanthomonas gardneri
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:xga00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BI317_04880
  Energy metabolism
   00680 Methane metabolism
    BI317_04880
Enzymes [BR:xga01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BI317_04880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1096090..1098804
Genome map
AA seq 904 aa AA seqDB search
MNEYRSSLVFATPDLALRDDVRRLGALVGDLLAEQVSAEFLEEIEHVRTTAIARREGDAP
PSTLSEQLTGREPREAESLVRAFSTYFQVVNIAERVHRIRRRREYQRSSTDTPQPDGLHD
ALRRLKAQGVTLDELSAWLPRIDVEPVFTAHPTEAVRRALLEKEQLMVASLVDNLDGMRT
PNERATDAARFRMALTASWQTADSSPVRPTVEDEREHVGFYLTQVLYRVVPVMYETLEHA
IEETYGSVPTLPRLLRFGTWVGGDMDGNPNVDAVTIAGTLDAQRRAVLDRYQKELWQLAS
LLSQSTTLVAVSSELSEQLERYRALLPEDAARSRPRHGDMPYRLLNDLMRARLQATLDDA
EGAYTAPSELEHDLQLILDSLQANKGLHAGWFAVRRLLWRVRTFGFHLARLDVRQESNVH
ARAVADALGQADWDDQDARQRAALLGPYASGEQVLPRVADEGNARLDAVFAALADARGRH
GADALGSYIISMAHNRADVLTVLALARRGGLVDDAGAVPLDIVPLFETVDDLRGGTGTVQ
DLLADPVYRQHLAARGDTQMVMLGYSDSGKDGGITASRWGLQRAQVELLEAAAELGVRLT
FFHGRGGSIARGGGKTSRALDAAPRGSVDGRLRVTEQGEVIHRKYGIRALALRSLEQMTG
AVLLSSLRPRAPEPREDRWRPVMDLVAEQSTVAYRAFVGAPDFMQYFRRATPIDVIERMT
LGSRPSRRLGQDAALSNLRAIPWVFAWSQARAVIPGWYGVGSGLQAAVDAGHEETLREMA
QDWPFFRTFLDDVAMVLSKGDLNIAELFSRLSGDLHERFFPGIRDELALTKGWVKALTGQ
QSLLQHDPRLALSIRLRNPYIDPISVLQVDLLQRWRATDGEDDELLRALVACVNGVSQGV
QNTG
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagtaccgcagcagtcttgtgttcgctacccccgatcttgccttgcgcgacgat
gtgcgtcggctcggtgcactggtcggtgacctgctcgccgagcaggtctctgcggaattc
ctcgaagagatcgaacatgtccgcaccacggcgattgcgcggcgcgagggcgatgcaccg
ccgtccacgctgagcgagcaactgaccggacgcgagccgcgcgaagccgagtcgctggtg
cgcgccttcagcacctatttccaggtggtcaacatcgccgagcgcgtgcatcgcatccgc
cgccgccgcgagtaccagcgcagcagcaccgacaccccgcagccggatggcctgcacgat
gcactgcgccggctcaaggcgcagggcgtgacgctggacgaactcagcgcgtggttgccg
cgtatcgacgtggagccggtgttcaccgcgcaccccaccgaagcggtgcggcgcgcgctg
ctggaaaaagaacagctgatggtcgccagcctggtcgacaacctggatggcatgcgcacg
cccaacgagcgcgccaccgatgcggcgcgcttccgcatggccctgaccgcctcctggcag
accgccgactcctcgccggtgcgtcccaccgtggaagacgagcgcgagcatgtggggttc
tatctcacccaggtgctgtatcgcgtggtgccggtgatgtacgaaaccctcgaacacgcc
atcgaagaaacctacggcagcgtgccgaccctgccgcgcctgttgcgcttcggcacctgg
gtgggcggcgatatggacggcaatcccaatgtggatgccgtcaccattgccggcacgctg
gatgcgcaacggcgcgcggtgctggatcgctatcaaaaggaactctggcaactggccagc
ctgctcagccagtcgaccacgctggtggcagtcagttcggaattgagcgagcaactggag
cgctaccgcgcactgctgccggaggacgccgcacgctcgcgcccgcgccatggcgacatg
ccgtatcgcctgctcaacgatctgatgcgcgcgcgtctgcaggccacgctggacgatgcc
gagggcgcctacaccgcaccgtccgagctggaacacgatctgcagctgattctggacagc
ctgcaggccaacaaggggctgcacgccggttggttcgcggtgcgccggctgttgtggcgc
gtgcgcacgttcggcttccatctggctcgtctggatgtgcgccaggaatcgaacgtgcat
gcgcgtgcggtggccgatgcattgggccaggccgattgggacgaccaggacgccaggcag
cgcgctgccttgctcggcccgtatgcctccggcgaacaggtgctgccgcgcgtggccgac
gaaggcaatgcacggctggatgcggtgtttgccgcgctcgccgatgcgcgcggccgccac
ggcgccgatgcgctgggcagctacatcatctcgatggcgcacaaccgcgccgacgtactc
accgtgctcgcgctggcgcgacgcggcggcctggtcgacgacgctggcgccgtgccgctg
gatatcgtgccgctgttcgaaaccgtggacgatctgcgcggcggcaccggcaccgtgcag
gatctgcttgccgacccggtctatcgccagcatctggctgcgcgcggcgacacccagatg
gtgatgctggggtattcggacagcggcaaggacggcggcatcaccgcctcgcgctggggc
ctgcagcgcgcgcaggtggagttgctcgaagccgctgccgagttgggcgtgcggctgacc
ttcttccacggccgcggcggctcgatcgcgcgtggcggcggcaagaccagccgtgcgctg
gatgccgcaccgcgtggcagcgtcgatggccgcctgcgcgtcaccgaacagggcgaggtg
atccatcgcaagtacggcattcgtgccttggcattgcgctcgctggaacagatgaccggc
gcggtgctgctctccagcctgcgcccgcgtgcgcccgagccgcgcgaggatcgctggcgc
ccggtgatggatctggtcgcagaacaaagcactgtcgcgtaccgcgccttcgtcggcgcg
ccggatttcatgcagtatttccgccgcgccacgccgatcgacgtgatcgaacgcatgacc
ctgggctcgcgcccgtcgcgccggctcggccaggatgcggccttgtccaacttgcgcgcg
attccgtgggtgttcgcgtggagccaggcgcgtgcggtgatcccgggctggtacggcgtg
ggcagcggcctgcaggcggcagtggatgcgggacatgaagagaccttgcgcgagatggcg
caggactggccgttcttccgcaccttcctggacgacgtggcgatggtgctgtccaagggc
gacctcaacatcgccgagctgttttcgcggctgtcgggtgacctgcatgagcgatttttc
ccgggcattcgcgacgaactggcgctgaccaagggctgggtgaaggcgttgacggggcag
caatcgctgctgcagcacgacccgcggctggccttgtcgatccgcctgcgcaacccctac
atcgacccgatcagcgtgctgcaggtggatctgctgcaacgctggcgtgccaccgatggc
gaagacgacgagctgctgcgcgcgctggtcgcctgcgtcaacggcgtctcgcaaggcgtg
cagaacaccggctga

DBGET integrated database retrieval system