KEGG   Xenopus laevis (African clawed frog): 100037245Help
Entry
100037245         CDS       T01010                                 

Gene name
ptgs1.S, cox1, ptgs1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase) S homeolog
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00590  Arachidonic acid metabolism
xla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100037245 (ptgs1.S)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100037245 (ptgs1.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 100037245
NCBI-ProteinID: NP_001091389
Xenbase: XB-GENE-995318
UniProt: A0A9J3
LinkDB All DBs
Position
8S
AA seq 587 aa AA seqDB search
MAGLCLTMLFMIVTSSYSLEVSTKVNPCCYYPCQHKGVCVRFEMEEYQCDCTRTGYYGTN
CTIPEWWTKFRELIRPSPAFYHYILTRFKWFWDIINSTFIRDFIVRLVLTVRSNLIPSPP
TYNSEYGYISWEAYSNVSYFTRVLPPVPHDCPTPMGTKGKKELPDATFLVETFLKREKFI
PDPQGTNLLFAFFAQHFTHQFFKTYGRMGRGFIKGFGHGVDLSHIYGDSLERQQILRLFK
DGKLKYQIINGETYPPTVVEAPVHMIYPENVPKEKQFAVGQEVFGLLPGLMMYATLWLRE
HNRVCDVLKKEHPTWDDEQLFQTTRLILIGETIKIVIEDYVQHLSGYYLKLKFDPELLFG
VQFQYRNRIAVEFNQLYHWHPLMPEKFKIIEDEFGYSSFIYNTSIILDYGVEALVESFTK
QIAGKIGGGKNHPPSLLKVAAGVIEESRNLRLQPFNEYRKRFGLKAYKSFRDLTGEEKMA
AQLEEFYGDIDALEFYVGLLLEKPNPNSIFGESMVEIGAPFPLKGLLGNPICSPEYWKPS
TFGGETGFNIVKTASIQKLVCLNVKTCPFVAFHVPDVLPTLKKSDEL
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggctggactctgtcttactatgctgtttatgattgtcaccagttcatattccctggaa
gtttcaactaaagtgaatccatgctgctactacccctgtcagcacaagggtgtttgtgtg
aggtttgaaatggaggaataccaatgcgactgcacccggacaggctattatggtaccaac
tgcacaatccctgaatggtggaccaaatttcgggaattaattcgtccaagtcctgctttt
tatcactacattttgaccagatttaagtggttttgggatataatcaattctaccttcata
cgtgatttcattgtgagacttgttttgacagtgcgttcaaatttgatacctagcccacca
acatacaattctgagtatggttacattagctgggaggcgtattctaacgtaagctacttt
acacgggttcttcctcctgtgccacatgattgtcctactccaatgggaacaaaaggaaaa
aaggaactcccagatgcaacttttcttgtggagacatttctgaaaagagaaaaattcatc
cctgacccacaaggcacaaacctcctctttgccttctttgcccagcattttacacatcag
tttttcaagacatatggcaggatgggacggggtttcattaaaggatttggccatggtgtt
gatcttagtcatatttatggagacagtttggaacgccagcagattcttcgcctcttcaaa
gatggaaaactcaaatatcagataataaatggggaaacatatcctccaacagtagttgaa
gctccagtccatatgatttatccagaaaatgtccccaaggagaagcaattcgcagtaggg
caggaggtatttggactcctccctggattgatgatgtatgcaaccctttggctccgcgaa
cacaatagggtttgtgatgttctgaagaaggagcaccctacttgggatgatgagcagctg
tttcaaactacaagactaattcttataggggagactataaagatcgtcattgaagactat
gttcagcatctaagtggatattatttgaaactaaaatttgatccagaattactgtttggc
gtgcagttccagtacaggaatcggattgctgttgagttcaaccagttatatcactggcat
cctcttatgccggagaaatttaaaattatcgaagatgaattcggctatagcagcttcatc
tacaatacttccattattttagactatggcgttgaggctctggtggaatccttcacaaaa
caaattgctggcaagattggtggcggaaagaatcatccacctagtctgttgaaggtggct
gcaggtgttattgaagaatcccgaaacctcagactacaacctttcaacgaatatcgaaag
agatttggattgaaggcttataaatcattcagagatttaacaggagaagaaaaaatggca
gcacaattggaagagttttatggagacatagatgcacttgaattttacgtggggttactt
ttggaaaaacccaatccaaattcaatatttggagaaagtatggtggaaataggtgcaccg
ttccctcttaaaggactactggggaacccaatttgctctccagaatactggaagcccagt
acctttgggggagaaactgggtttaatattgtaaagactgcctctattcagaagcttgtg
tgtctcaatgtaaaaacatgcccatttgttgcattccatgtgccagatgtattacctaca
ttaaaaaaatctgatgagctttaa

DBGET integrated database retrieval system