KEGG   Xenopus laevis (African clawed frog): 108701765Help
Entry
108701765         CDS       T01010                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     108701765
Peptidases [BR:xla01002]
 Metallo Peptidases
  Family M2
   108701765
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108701765
CD molecules [BR:xla04090]
 Proteins
  108701765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
9_10L
AA seq 1221 aa AA seqDB search
MHFTAAPGGTQTMRGVLLGLLLVVGTASALDSSYLPKDYPKDEAGARAFADDYNSTAETI
LFKSVEASWAYNTNLTEYNSQQQILASMEEQEFNEAWGKKAKELFNDVWENFSDPLLKNI
ISSIRTLGASNLNISMREEYNTILSQMDSIYSTSKVCPPNPNEKCWSLEPELTEIMATSR
SYKKLLYAWDGWHNSAGIPLKEKYLKFVQLSNDAYRMDDGREDDCCSTSTGNSTLPRLVS
YNYGSLLFAGNMWSQQWNNIYDMMIPFPDKTNIDVTNTMREKGWNATHMFRVSEEFFTSL
GLLEMPPEFWDKSMLEKPADGREVVCHASAWDFYNRKDFREAEYKYFLLRSSHMVADDKL
IVCSVPLLAESDINYLLKMALEKIAFLPFGYLIDQWRWNVFSGRTPPSRYNYDWWNLRTK
YQGICPPIARDDAQFDAGAKYHIPGNTPYIRYFVSFVLQFQFHKALCAAANHTGPLHTCD
IYRSKEAGKILGDVLRSGSSRPWQEVLKNMTGTDKMDVGPLLEYFTPVTKWLTEQNTKNN
EILGWPEFSWTPPIPDGYPGDIEKIANEKEADTFLSNYNKSAEVVWYEYAEASWAYNTNI
TEANKDVMLDKNLAMSAHTLQYGMQARNYDYSDFQSPETQRILRKLSEIDKAALPEVEQK
EYNQILSDMETIYSVAKVCRNGNKDCLPLDPDLTEILAKSRDYDELLFAWQGWRDASGKQ
IRGKFKRYVELTNKAAQLNGYADNGAYWRSWYETPTLETDVEQLYEELQPLYLNLHAYVR
RALYKKYGDKKINLKGPIPAHLLGNMWAQSWSNIYDLLVPYPNAAQVDATPAMIAKNWTP
KRMFEESDNFFKSLGLLPMPQEFWDKSMIEKPKDREVVCHASAWDFYNRKDFRIKQCTVV
NMDDLITVHHEMGHVQYFLQYKDQPILFREGANPGFHEAIGDVLALSVSTPKHLQSIGLL
DKVEDNAESDINYLMSIALDKIAFLPFGFLMDQWRWKVFDGRTPDSEYNQQWWNLRLKYQ
GLVPPVPRSENDFDPGAKFHIPASVPYIRYFISFVIQFQFHEALCKAANQQGALHKCDIY
RSTEAGKLLGDAMKLGNSKPWPEAMQLITGQRNMSAHALLKYFQPLTDWLIKENTKNSET
LGWPEYNWTPVQAVDPLPPSEESNSNSDFLGMAVSNGQAAAGQWILLALGIVLVITTIIF
GVMYSKMKSRAKMSSSQMELK
NT seq 3666 nt NT seq  +upstreamnt  +downstreamnt
atgcatttcacagcagcacctggaggcacccaaaccatgaggggggttctcctggggctc
ctcctggtggtgggcaccgcttcagccctggacagctcctacctgccgaaagactacccc
aaggatgaggctggtgccagagcatttgccgatgactacaacagcacagcagagactatc
ctattcaagagtgtggaagccagttgggcatataacaccaacctgactgaatacaactcc
cagcagcagattctagcttccatggaggagcaggagtttaatgaggcatggggtaagaag
gccaaggaactgttcaatgatgtgtgggagaacttctcagatccactgctcaagaacatc
atcagttctatcaggacccttggagcatcaaacctgaacatttcaatgagggaggagtat
aacactattctcagtcagatggatagcatctattcaacatccaaagtgtgccctccaaat
ccgaatgagaaatgctggtctttggaaccagaactaacagagatcatggcaacatccagg
agctacaaaaagcttctctatgcctgggacggctggcataactctgcagggattccactg
aaggagaaatacttgaaatttgtgcagctcagtaatgatgcttacaggatggatgatggg
agggaagatgactgctgtagcactagtactggaaatagtacacttccacggctagtctca
tataactatggctctttgctttttgcaggtaacatgtggtcccagcagtggaataatatc
tatgacatgatgattcctttcccagacaagaccaatatagatgtcacgaatacaatgagg
gaaaagggatggaacgctacccatatgttcagagtttcagaggagttcttcacctccctg
ggcctgctggagatgccaccagagttttgggataagtcaatgttggaaaagccagcagat
ggacgggaggtagtgtgccacgcatctgcatgggacttctacaaccgtaaggatttccgg
gaggctgagtataagtacttccttctccggtcctcgcatatggttgcggatgacaaactc
atcgtttgctctgttccccttttggcagaaagtgatatcaattatctgttgaaaatggct
ctggagaagattgccttcctgccgtttggctacttgattgatcagtggagatggaatgtc
ttcagtggccgcacacctcccagcagatacaactatgactggtggaaccttcgaacaaaa
tatcaaggcatttgcccaccaatcgcaagagatgatgctcagtttgacgcaggagcaaag
tatcatattccaggcaacacaccttacatcaggtactttgtgagttttgtgctgcagttc
cagttccacaaggctctctgtgcagctgccaatcatacaggtcccctgcatacctgtgac
atctacaggtctaaagaggctggcaaaattcttggagatgtcctccggtcaggatcttcc
cggccttggcaggaggttctaaagaacatgacaggtactgacaagatggatgttggacct
ttgcttgaatacttcacccctgtcacaaagtggctgactgagcagaacaccaaaaataac
gagattcttggctggccagaattttcatggacacccccaatacctgatggatatccagga
gatattgaaaaaatagcaaatgagaaagaagccgatacattcctgtctaattacaacaag
tcagcggaggtggtgtggtatgaatacgcagaggcatcatgggcctacaacacaaacatc
accgaggccaacaaggatgtcatgctggacaaaaacctggccatgtcggcacacactttg
caatatggaatgcaggcaagaaactatgattacagtgatttccagagcccagagacacag
cgcatactgaggaagctcagcgagatcgataaagctgctcttccagaggtggaacagaaa
gagtacaatcaaatcctgtccgacatggagactatttatagtgtggccaaagtgtgcagg
aatggtaacaaggactgccttccccttgatccagacttaacagagattttggccaagtca
agggactatgatgagcttttgtttgcttggcaagggtggagagatgcttcaggcaaacaa
atccgtggaaaattcaagagatacgtagaactgaccaacaaagctgctcagctcaatggt
tatgcggacaatggtgcatactggagatcttggtatgagaccccaacacttgaaactgac
gttgaacaactttatgaggagttgcagcctctctacctcaatttgcatgcatatgtgcgc
agggctctttacaagaagtatggagataaaaaaatcaacctaaaggggcccattccagct
catcttttgggtaacatgtgggcacagtcctggtccaacatttatgacttattggtacca
tatcccaatgctgcacaagtagatgccactccagcaatgattgctaagaactggactcca
aaaaggatgtttgaagaatctgacaacttcttcaagtctctggggcttctaccaatgccc
caggaattctgggacaaatccatgattgagaagcctaaagacagagaagtagtgtgccat
gcctctgcttgggacttctacaaccgcaaagatttcagaattaaacagtgtacagtggtt
aacatggacgacctcatcactgtccaccatgagatgggacacgtccagtatttcctccag
tacaaagatcagcctatcttgttccgtgagggagccaacccaggtttccatgaagcgatt
ggggatgttcttgctctttcagtctctacaccaaagcacttgcagagcattggacttttg
gataaggtggaggacaacgcagagagcgatattaattatctgatgagtattgcgctggat
aaaattgccttccttccatttggcttcctgatggatcagtggcgctggaaggtctttgat
ggcagaacaccagattcagaatacaaccaacagtggtggaacctcagactgaagtatcag
ggcttagttcctccagtaccaaggagtgaaaatgattttgatccaggtgctaagttccac
attccagccagtgtaccctacatcaggtacttcatcagtttcgtcatacagttccagttt
catgaagctctttgtaaagcagccaatcaacaaggagctctacacaagtgcgatatctat
cgatccacagaggccggaaaactacttggagatgccatgaagttgggtaacagcaaacct
tggccagaagctatgcaactaattactgggcagaggaacatgtctgctcacgcccttctc
aaatacttccagcccctgactgattggcttatcaaggagaatacgaagaacagcgaaacc
ttaggatggccagaatacaactggaccccagtgcaagctgttgatcctctcccaccatct
gaagagtctaactctaactctgacttcttgggaatggcggtcagcaatggccaagcagct
gctggacaatggattctgctggctttgggcatcgtcctggtcatcaccactataatcttt
ggtgtgatgtactcaaagatgaaaagcagagccaagatgtccagctctcaaatggagctg
aaatag

DBGET integrated database retrieval system