KEGG   Xenopus laevis (African clawed frog): 394323Help
Entry
394323            CDS       T01010                                 

Gene name
hk1.L, Hexokinase, hk1, hk1-A
Definition
(RefSeq) hexokinase 1 L homeolog
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00010  Glycolysis / Gluconeogenesis
xla00051  Fructose and mannose metabolism
xla00052  Galactose metabolism
xla00500  Starch and sucrose metabolism
xla00520  Amino sugar and nucleotide sugar metabolism
xla00524  Neomycin, kanamycin and gentamicin biosynthesis
xla01100  Metabolic pathways
xla01200  Carbon metabolism
xla04910  Insulin signaling pathway
Module
xla_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
xla_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    394323 (hk1.L)
   00051 Fructose and mannose metabolism
    394323 (hk1.L)
   00052 Galactose metabolism
    394323 (hk1.L)
   00500 Starch and sucrose metabolism
    394323 (hk1.L)
   00520 Amino sugar and nucleotide sugar metabolism
    394323 (hk1.L)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    394323 (hk1.L)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    394323 (hk1.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     394323 (hk1.L)
Membrane trafficking [BR:xla04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    394323 (hk1.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 394323
NCBI-ProteinID: NP_001096656
Xenbase: XB-GENE-944854
UniProt: Q6GQB4
LinkDB All DBs
Position
7L
AA seq 916 aa AA seqDB search
MIAAQLLAYYFTELKDDQLKKIDKYLYAMRLSDETLLDITGRFRAEMANGLSRDTNPTAI
IKMLPTFVRSIPDGTEKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESEIYDTPEDIIH
GSGTRLFDHVAECLGDFMQKKQIKDKKLPVGFTFSFPCIQTKIDEGVLVTWTKRFKASGV
EGMDVVKLLNRAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDMVEGDEGRMCINTEWGAFGDEGCLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELLTRGKFETKHISAIEKSKEGLSKAKDILTRLG
VEPSHEDCIAVQHVCTIVSFRSANLVAATLGGILIRLRDNKGVPRLRTTVGIDGSLYKMH
PQYARRLHKTVRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLSEQRRQIDETLEEFKLS
REQLLEVKRRMRIEMENGLRKKTHESAKVKMLATFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPTDVMQGTGEELFDHIVHCISDFLDYMGIKGARLPLGF
TFSFPCKQTSLDAGILVTWTKGFKSTDCEGEDVVNLLREGIKRREEFDLDVVAIVNDTVG
TMMTCAYEDPNCEIGLIVGTGSNACYMEETKNIEMVDGEQGRMCVNMEWGAFGDNGCLDD
IRTVYDKAVDELSLNSGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISEALKTTS
IFETKFLSQIESDRLALLQVRSILQQLGLNSTCDDSIIVKEVCGAVSRRAAQLCGAGMAA
VVDKIRENRGLDHLDVTVGVDGTLYKLHPHFSKIMHQTVKDLAPKCNVSFLLSEDGSGKG
AALITAVACRLRTEQN
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgattgctgcccagctgctggcctattacttcactgaactgaaagatgatcagctcaag
aagattgataaatatttgtacgctatgcgcctttccgatgaaaccttactggatattacg
gggaggttcagagcagaaatggcaaatggtctttcaagagacacaaaccccacagcaatt
attaagatgttgccaacatttgtaagatcgatccccgatggaacagaaaagggagatttc
atcgctttggatttgggtggatctaattttcgcattttgagagtgaaggtctcgcatgag
aagaagcagacagtccagatggagagtgagatctatgatacaccagaggacattatccat
ggtagtggtactagactttttgaccatgttgctgaatgcctcggagacttcatgcagaag
aaacagatcaaagataaaaagctgcctgttggatttaccttctccttcccttgtatacaa
accaaaatagatgagggtgtactggttacctggaccaagagattcaaagccagtggggtt
gagggaatggatgttgtaaaactgctaaacagggcaatcaagaaacgaggggactacgag
gcagatataatggcggtcgtgaatgacacagttgggacaatgatgacttgtgggtttgat
gaccagagatgtgaagttggtataatcataggtactggaaccaacgcttgctacatggag
gagttgaggcacattgatatggtggagggggatgagggtcgaatgtgcattaacactgag
tggggagcatttggtgatgaagggtgtctggaggacatcaggacagaatttgacagagag
atagaccgtggttcacttaatccaggaaaacagctgtttgaaaagatggtcagcggaatg
tacatgggggaacttgtcagacttatcttggtaaaaatggcgaaagaaggactcctgttt
gaaggaaggatcactccggagcttctgaccagagggaaatttgaaacaaagcacatctct
gcaattgagaagagcaaagaaggtttaagcaaagctaaagacatattgaccaggcttggg
gtagagccatctcatgaagactgcattgctgtgcagcatgtatgtacaatcgtttccttc
cgctctgctaatctagttgctgctacacttggtggaatcctgatacggctacgagacaat
aaaggggtccccaggctccgtactactgtgggcattgatggatccttgtacaagatgcat
ccacaatatgccaggcgcttgcataaaacagtaagacgattggttccagactcggatgtg
agattcctcttatccgagagtggcagtggtaaaggagctgccatggtaactgcggtggca
tacaggctgtcagaacagagacggcagattgacgagaccttagaagagttcaagctcagc
cgtgaacagttgcttgaagtgaagcggaggatgcggattgaaatggagaatggactccgg
aaaaagactcatgaatctgcaaaggttaaaatgttagcgacatttgtaaggagtacacca
gatggcacagaaaatggagactttctggcactggaccttggtggtacaaactttagagtt
ttacttgtgaaaattcgaagtgggaaaagaagaaccgtggaaatgcacaataaaatctat
gccatccctacagatgtcatgcaggggacaggggaagagctgtttgatcacattgttcat
tgtatttctgatttcctggattacatgggaattaagggagcaagacttcccctgggcttc
actttctcgttcccctgcaagcagaccagcttggatgctggcatattagtcacatggacc
aaaggtttcaagtccactgattgtgagggagaagatgtggttaatctattaagagaagga
attaagagaagagaggagtttgacctggatgtggttgcgattgtgaatgatacagtagga
accatgatgacctgtgcatatgaagatccaaactgtgaaattggtctgatcgttgggact
ggcagcaatgcatgctacatggaagagacaaagaacatagaaatggtggatggagaacag
gggagaatgtgtgtgaacatggaatggggagcatttggggacaatggatgtcttgatgat
atccgcacagtctatgacaaggctgtcgatgaattgtcattaaattcagggaaacaaagg
tatgagaagatgatcagcggcatgtatttaggagaaattgtgcgcaacatattaattgac
ttcacaaaaagaggattcctgttcagaggacagattagcgaggcgctgaaaaccacaagt
atctttgaaaccaaattcctttcccaaattgagagtgacagattagctttgctccaagtc
cggtctatccttcagcaattaggtctgaacagcacctgcgatgacagtataattgtaaag
gaggtgtgtggagctgtatctagaagggcagcccagttgtgcggtgcaggcatggcagcc
gttgtggataaaatccgagaaaacaggggcttagaccatctggacgtcacagttggagtt
gatggaacattatataaattacatccacacttctccaaaatcatgcaccaaacagttaag
gacctcgccccgaagtgcaatgtctcttttctcctctcggaggatgggagcggtaaagga
gcggctctgatcactgctgtggcctgcagactccgcaccgaacaaaactaa

DBGET integrated database retrieval system