KEGG   Xenopus laevis (African clawed frog): 444204Help
Entry
444204            CDS       T01010                                 

Gene name
kmt5b.S, cgi-85, cgi85, kmt5b, kmt5b-a, suv420h1, suv420h1-a
Definition
(RefSeq) lysine (K)-specific methyltransferase 5B S homeolog
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    444204 (kmt5b.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     444204 (kmt5b.S)
Chromosome [BR:xla03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     444204 (kmt5b.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
UniProt: 
LinkDB All DBs
Position
4S
AA seq 855 aa AA seqDB search
MKWLGESKNMVVNGRRNGNRLSAELRQNQPKLHSPGRENLRTSKNVPDRRSGRFGNVAFE
AQSRYVPSSGMSAKELSENDDLATSLVLDPYLGFQTHKMNARFRPIKGRQEELKEVIENF
KKKEHLEKTFKNLVAGDWSRHYFLNKTKMQEKHFKEHVFIYLRMFATSSGFEILPCNRYS
SERNGAKIVATKEWKRNDKIELLVGCIAELSEAEENMLLRHGENDFSVMYSTRKNCAQLW
LGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYTC
ERRATGAFKSRVGLNEPGPLINSKYGLRETDKRLNRLKKLGDSGKNSDSQSVSSNTDADT
SQEKDMSNRKSNGMRKRSKSRTLRRRSMSRIPVSSSSTSSKLPHINNSRVPKRLRKPPKP
FHSKLKIRCHRKKVEQKKASKKLEVSNLVLKEPKVVLYKNLAIKKDRESQGAVPVTETTG
CLTRHAAREYKLNSLKGAHSHGESSSCTYITRSSLRTRFKSNDMSEAKLQHNSVDGYRSS
HGTVLQVDKSEPLCQSTCKNELLQETPRQTIRFHRNNFNTSTRNSRQNRYIKQASKVEDS
VSSVYDQSSKDHALPDLGNSHCDLGEGNALIQTSPDYKSFESSADEYPLVTSEITKTKKN
NRTAKNKKSRRITRYDAQLILENSTGIPKLTLRRRHDSNSSKTNEKENEGMSSSKISIKL
SKDHEKDNGLYVAKLNNGFNSGSGSTSTKLKIQLKRDEENRTAFPNENGMYCNDTLSLLE
TRMKVDGYDHYEEESVEESSTEEDEEEEDEYDDEFEDDFIPLPPAKRLRLIVGKDSIDID
ISSRRREDQSLRLNA
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggcgaatccaagaacatggtagtgaatggcaggagaaatggaaaccga
ttgtctgctgagcttcgacagaaccagccaaaactgcacagccctgggagagagaattta
agaaccagcaaaaatgttccggacagaagatcaggcaggtttggtaatgtagcatttgaa
gcacaaagtcgctatgtaccatcatctggaatgtccgctaaggagctgagtgaaaatgat
gaccttgcaaccagtttggtcttagatccctacctaggatttcagacacacaaaatgaat
gccagatttcgccctataaaaggacgtcaggaagagctaaaggaggtgattgaaaacttt
aagaaaaaagaacatcttgaaaaaaccttcaaaaatttagtagcaggtgactggtctcgg
cactatttcctcaacaagaccaaaatgcaggaaaagcatttcaaggagcatgtttttatc
tacttgagaatgtttgcaactagtagtggctttgaaattctgccttgcaatagatactcc
tccgagagaaatggagccaaaatagttgcaactaaagaatggaagcggaatgataaaatt
gagctgcttgtgggctgcattgctgaattatctgaagcagaggaaaacatgcttctacgt
catggggaaaatgactttagtgtcatgtattcaacaaggaaaaactgtgctcagctgtgg
ctcgggcctgctgccttcatcaaccacgactgccggcctaactgtaagtttgtatccact
ggccgtgacactgcatgtgttaaagctctccgagatattgaacctggagaagaaatctct
tgttattatggggatggtttttttggagaaaacaatgagttttgtgaatgttacacttgt
gaaagacgtgcaactggtgcttttaaatcacgtgttggacttaatgaaccaggccctctg
ataaacagcaaatacggactccgggaaacagacaaacgcttaaaccgtctaaaaaaactc
ggagatagcggtaaaaactcagacagccagtcagtgagctctaatactgatgcagacaca
tctcaggaaaaagacatgtcaaatagaaaatcgaatggaatgcgaaagagaagtaaaagc
agaacactgaggagacgttccatgtccagaattcccgtttcatcatcatctacctcatcc
aagcttcctcacattaataattccagggtaccaaagagactaagaaagcctccaaagcct
tttcattcaaaattaaagataagatgtcatcgcaaaaaagtagagcaaaagaaagcttct
aagaagcttgaagtttcaaacttggttcttaaagaacctaaagttgtgctgtataaaaac
ttggcaatcaaaaaagatagggaaagtcaaggtgcagttccagttactgaaacgactggt
tgtttaactagacacgctgcaagagaatataaactaaattccttaaaaggtgctcattct
catggtgaatcctcatcgtgtacttacatcactcggagttctttgagaaccagatttaaa
tccaacgatatgtccgaggctaagcttcaacacaattcagtcgatggttatagaagcagc
cacggaactgttctacaggtggataaaagtgaaccactctgtcagtcaacttgtaaaaat
gaactgcttcaagaaaccccaaggcaaactatcagatttcacaggaacaactttaacaca
tctacaagaaattctcgacaaaatcgatatatcaagcaagcctccaaagtcgaagattca
gtgtcgtccgtctatgatcaatcaagcaaagaccatgcattaccagacttaggaaattca
cattgtgatttaggtgaagggaatgccctcattcagacttctcccgattataagagcttt
gaaagctccgcagacgaataccctttagtgacttctgaaattaccaagacaaaaaaaaat
aatcggactgcgaaaaataaaaaaagcagacgcataaccagatatgatgcacaattgatt
cttgagaacagcactggaattccaaagctaacccttcgaaggcgacatgacagtaacagt
agcaagaccaatgaaaaggagaatgaagggatgagttcatcaaaaataagcattaaatta
agcaaggatcatgaaaaggacaacggcttgtatgttgcaaagctcaacaatggttttaac
tcaggatcagggagcacttcaacaaagttgaagatacagctaaagcgggatgaggagaac
agaacggcgtttcctaacgagaatggaatgtattgcaatgacaccttatctctgttggaa
acaagaatgaaagttgatggttatgatcactacgaggaggaaagtgtagaagagtcttca
acagaagaagatgaagaggaggaagacgagtatgatgatgaatttgaagacgattttatc
ccccttcctccagcaaagcgtttgagacttattgttggaaaggactccatagacattgat
atatcttccagaaggagagaagatcaatccttaagactcaatgcataa

DBGET integrated database retrieval system