KEGG   Xiphophorus maculatus (southern platyfish): 102218232Help
Entry
102218232         CDS       T02923                                 

Definition
(RefSeq) histone deacetylase 4-like
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:xma00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    102218232
Enzymes [BR:xma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102218232
Chromosome [BR:xma03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102218232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
Un
AA seq 1075 aa AA seqDB search
MTSNSHQEGILGKEQSLEVLKTSALNHIPTVDINSALPLRLPPAAIPMDLRVDHHHQQQQ
QVSSLSPPGPSVREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLQEHIKQ
QQELLALKHQQELLEHQRKMENHRLEQELEKQQREQKLQLLKNKERGQESAVASTEVKMR
LQEFVLNKKKALAQRSLNQGGLPNDAPYWYRKTQHSSLDQSSPPQTAVSTYNHPVLGVYN
PRDDFPLRKTASEPNLKLRSRLKQKVSERRSSPLLRRRDSPITTAKKRSLDMADSACSSA
PGSGPSSPNNSSNNIPNENGITVSISNNMEASLAQRLCGGGDQGSINQLSLYTSPSLPNI
TLGLPATATATAASNVRRKSDAGLQPALSLSPPFLSGGHLSPYLADSGSGGHGAHSPLLQ
HMVLMEQSPAQSPLVTGVSGMSMSSASMAKLQRQHRPLGRTQSAPLPQGSAAQAHAQALA
LQQLVVQQQHQQFLEKHKQQFQQQQLHLNKMMGKPGESPVGRQHQSHPEETEEELREHQD
AGALPPGVTIKQEPPDPQELQELQELQEEALQQHREREQELLFRQQALLLEQQRIHQLRN
YQASMEAAGMSMSFPGHRPLSRAQSSPASASSFPISVPTQDPPVKPRFTTGLVYDSLMQK
HQCMCGNTNSHPEHAGRIQSIWSRLQETGLRAQCECIRGRKAALEELQTVHSEAHVLLYG
TNPLRQKLDCSITPMFVRLPCGGVGVDSDTIWNEVHSSSAARLAVGSVVELVFKVATGEL
KNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLSVSKILIVDWDVHHGNGTQQA
FYDDPNVLYMSIHRYDDGNFFPGSGAPDEVGSGPGVGFNVNVAFTGGLDPPMGDSEYLTA
FRSVVMPIADEFAPDIVLVSSGFDAVEGHPPPLGGYTLTSKCFGYLTRQLMTLAGGRVVL
ALEGGHDLTAICDASEACVAALLGQELDPLPKAVLEQRPNPNAVRSLERVIETHSKYWRS
VHRYSSRLGLSLLEAKRGDSEEAEAVSAMASLSVANTNTMDQRTEEEPMEEEAPL
NT seq 3228 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaacagccaccaagagggaatcctggggaaggagcagtcgctcgaggtcctc
aagacgtcggcgctcaaccacatcccaacagtggacattaactctgcgctgcccctgcgt
ctgccccctgctgccatccccatggacctgcgcgttgatcaccaccaccagcagcagcag
caggtgtcgtcactctccccgccaggcccctcggtgcgcgagcagcagctgcagcaggag
ctgctggctctgaagcagaagcagcagatccagaggcagatcctgatcgccgagttccag
cggcagcacgagcagctgtcccgccagcatgaggcccagctccaggagcacattaagcag
caacaggagctgctggccctgaagcaccagcaggagctgctggagcaccagaggaagatg
gagaaccaccggctggagcaggaactggagaagcagcagagggagcagaagctgcagctg
ctgaagaacaaggagcggggccaggagagtgctgtggccagcaccgaggtgaagatgcgt
ctgcaggagttcgtcctgaacaagaagaaggcgctggcccagcggagcctcaaccagggt
ggcctccccaacgacgccccctactggtaccgaaaaacccaacatagctctctggaccag
agctcgcctccacaaaccgcagtgtccacctacaatcacccggtgctgggcgtctacaac
cctcgggatgacttcccactgcgaaagaccgcctcggagcccaacctgaagctgcgctcc
cggctgaagcagaaagtgagcgagcgccgcagcagcccgctgctccgccgcagagacagt
cccatcactacggccaagaagcgctccctcgacatggcggactcggcatgcagcagcgcc
cccggctccggccccagctccccgaacaacagctccaacaacatccccaacgagaacggc
atcactgtgtccatctccaacaacatggaggcgtctctggcccagcggctgtgcggcggc
ggcgatcagggctccatcaaccagctgtctctctacacctcgccgtccctccccaacatc
accctggggctgccggccactgccaccgccaccgccgcctccaacgtaaggaggaaatca
gatgcaggcctgcaaccagccctctccctcagccccccctttctgtccggcggccatttg
agcccctaccttgcagatagcgggtccggcggccacggcgctcacagccccctgctgcag
cacatggttctgatggagcagagtcccgctcagagcccgctggtgacaggcgtaagcggc
atgtccatgtcatcggcctccatggccaagctgcagcggcagcaccggcccctggggcgg
acccagtcggcgccgctgccccaggggagcgccgcccaggcccacgctcaggccctggcc
ctgcagcagctggtggtgcagcagcagcaccagcagttcctggagaagcacaagcagcag
ttccagcagcagcagctccacctcaacaagatgatggggaagcctggcgagtcgcccgtg
gggcggcagcaccagagccacccggaggagacggaggaggagctgagggagcaccaggac
gccggggccttgccaccgggggtcaccatcaagcaggagccgccggacccacaggagctg
caagagctgcaagagctgcaggaggaggcactgcagcagcaccgcgagcgggagcaggag
ctgctcttcagacagcaggctctgctgttggagcagcagcggatccaccagctgaggaac
taccaggcgtccatggaggctgccggcatgtccatgtccttccctggacacagacccctg
tccagggcgcagtcgtctccggcctcggcgtcgtccttccccatcagcgtccccacgcag
gatcctcccgtcaagcctcgcttcaccacaggcctggtgtatgactccctgatgcagaag
caccagtgcatgtgtggaaacaccaacagccacccggagcacgccgggcgcatccagagc
atctggtcccggctgcaggagaccggactccgagctcagtgcgagtgtatccgtgggagg
aaggccgctctggaggagctgcagacggtccactctgaagcccacgtcctgctgtacgga
accaacccactccggcagaaactcgactgttccataacgcccatgttcgttcggctgccg
tgcggaggagtgggggtggacagcgacaccatctggaacgaggtccactcgtccagcgcg
gctcggctcgccgtcggctccgtcgtggagctggtcttcaaggtggcaaccggagagcta
aagaacggttttgcggtggtccgccctcctggacaccacgccgaggaaagcacccccatg
ggcttctgctacttcaactcggtggccatcgcggccaaactgctgcagcagagactcagc
gtcagtaagatcctcatcgtggactgggatgttcaccatggcaatggcacccagcaggcc
ttctacgacgaccctaatgtcctctacatgtctatccatcgctacgacgacggcaacttt
tttccaggaagtggagcacccgatgaggtggggagcggtccaggggtggggtttaacgtc
aacgtggccttcaccggaggcctggacccccccatgggagactcagagtacctgactgcc
ttcaggtctgtggtgatgccgatagccgacgagttcgctccagacatcgtgctggtctcc
tctggcttcgatgccgtggaaggacaccccccaccgctgggcggctacaccctgacctcc
aaatgttttgggtatctgaccagacagctgatgaccctcgctggaggccgggtggtcctg
gcgctggagggaggtcacgacctcactgcgatctgtgatgcctctgaggcctgcgtggcc
gccctgcttggacaagagctagatccgcttccaaaggccgtcctggagcagaggcccaac
cccaacgcagtgcgctctctggagagagtcatagagactcacagtaagtactggcgctcg
gtgcatcgttactcatcgcggctgggactctctctgctggaggccaagcgaggcgactcg
gaggaggccgaggccgttagcgccatggcgtctctgtctgtagccaacaccaacacaatg
gatcaaaggactgaggaggagcccatggaggaggaggctccgctgtaa

DBGET integrated database retrieval system