KEGG   Xiphophorus maculatus (southern platyfish): 102219315Help
Entry
102219315         CDS       T02923                                 

Gene name
sod2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
FoxO signaling pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:xma00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    102219315 (sod2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    102219315 (sod2)
Enzymes [BR:xma01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     102219315 (sod2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
15
AA seq 225 aa AA seqDB search
MLCRAGELRRCAASLSQSICKVAASRQKHTLPDLTYDYGALEPHINAEIMQLHHSKHHAT
YVNNLNVTEEKYEEALAKGDVTAQVALQPALKFNGGGHINHTIFWTNLSPNSGGEPQGEL
MEAIKRDFGSYQKMKEKMAAVTVAVQGSGWGWLGYDKESGRLRIAACANQDPLQGTTGLI
PLLGIDVWEHAYYLQYKNVRPDYVKAIWNVINWENVHERLQIAKK
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgctttgcagagctggagaactacgcaggtgtgctgccagcctcagccaaagtatttgt
aaggtagctgcatcgaggcagaagcacacacttcctgacctgacatacgactatggagcc
ctggagcctcacatcaatgcagagataatgcagctacaccacagcaagcatcatgccaca
tatgttaacaaccttaacgttacggaggagaaatatgaggaggctctcgcaaagggagat
gtgactgcacaagttgcccttcagcctgctttaaagtttaatggaggtggccacattaat
cacaccatcttttggacgaatctctcaccaaatagtggcggtgaaccccaaggggagctg
atggaggccatcaaacgggactttggctcctaccagaagatgaaagagaagatggcagct
gtcacggtagctgttcagggctcaggctggggatggctcggttacgacaaggagagcgga
cgacttcgcattgctgcttgtgctaaccaggatccactgcagggcactacaggcctcatc
cctctccttggcattgacgtatgggagcatgcctactatctccagtacaagaatgtgcgc
cctgactatgtgaaggctatctggaatgtaatcaactgggagaacgtgcacgaacgtcta
cagattgccaaaaagtag

DBGET integrated database retrieval system