KEGG   Xanthomonas oryzae pv. oryzae MAFF 311018: XOO3578Help
Entry
XOO3578           CDS       T00360                                 

Gene name
XOO3578
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF 311018
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    XOO3578 (XOO3578)
  Energy metabolism
   00680 Methane metabolism
    XOO3578 (XOO3578)
Enzymes [BR:xom01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     XOO3578 (XOO3578)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4045283..4047997)
Genome map
AA seq 904 aa AA seqDB search
MNEYRSSLVFATPDLPLRDDVRRLGALVGDLLAEQVSAEFLDEIERVRTTAISRRESDAP
PSTLSEQLTGREPRDAEALVRAFSTYFQVVNIAERVHRIRRRREYQRSGTDTPQPDGLHD
ALRRLKAQGVTLDELSQWLPRIDVEPVFTAHPTEAVRRALLEKEQLMVASLVDNLDGMRT
PNERTSDAARFRMALTASWQTADSSPVRPTVGDEREHVGFYLTQVLYRVIPVMYETLEHA
IEETYGSVPALPRLLRFGTWVGGDMDGNPNVDANTIAGTLDAQRRAVLDRYQKELWQLAS
LLSQSTTLVQVSPELMTQLERYRALLPDAAARSRPRHGDMPYRLLNDLMRARLQATLDDA
DGAYTAPSELEDDLQLILDSLQANKGLHAGWFAVRRLLWRVRSFGFHLARLDVRQESSVH
ARAVADALGQTDWDAQDATRRAAVLGPYACGQEALPRVQDEGNARLDAVFAALADARTRH
GADALGSYIISMAHNRADVLTVLALARRGGLVDAAGAVPLDIVPLFETVDDLRGGTGTVQ
DLLADPVYRQHLAARGDTQMVMLGYSDSGKDGGIAASRWGLQRAQVELLEAAADLGVRLT
FFHGRGGSIARGGGKTSRALDAAPRGSVDGRLRVTEQGEVIHRKYGIRALALRSLEQMTG
AVLLSSLRPRAPEPREARWRPVMDLVAERSTVAYRAFVAAPEFMQYFRLATPIDVIERMT
LGSRPSRRLGQDAALSNLRAIPWVFAWSQARAVIPGWYGVGSGLQAAVDAGHEDSLREMA
QDWPFFRTFLDDVAMVLSKGDLNIAELFSRLSGDLHTRFFPLIRDELALTKGWVKALLQQ
QSLLQHDPRLALSIRLRNPYIDPISVLQVDLLQRWRATDGEDEALLRALVACVNGVSQGL
QNTG
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagtaccgcagcagtcttgtgttcgctacccccgatcttcccttgcgcgacgat
gtgcgtcggctcggtgcactggtgggtgatctgctcgccgagcaggtgtctgcggaattc
ctcgatgaaatcgaacgcgtgcgcaccaccgccatctcgcggcgcgaaagcgatgccccg
ccctccacgttgagcgaacaactcaccgggcgcgagccgcgtgatgccgaagcgctggtg
cgcgccttcagtacctatttccaggtcgtcaatatcgccgagcgcgtgcaccgcatccgc
cgccgccgcgagtaccagcgcagcgggaccgacacgccgcagccggatggcctgcacgac
gcattgcgtcggctcaaggcgcagggcgtgacgctggacgaactcagccagtggttgccg
cgcatcgatgtggagccggtgttcaccgcgcatcccaccgaggcggtgcgccgcgcgctg
ctggaaaaagagcagctgatggtcgccagcctggtcgacaacctggacggcatgcgcacg
cccaatgagcgcaccagcgatgcggcacgtttccgcatggcgttgaccgcatcgtggcag
accgccgattcctcgccggtgcgccccaccgtgggcgacgagcgcgagcatgtgggcttc
tatctcacccaggtgctctaccgcgtcatcccggtgatgtacgaaaccctcgaacacgcc
atcgaagaaacctatggcagcgtgccagccctgccgcgcctgctgcgtttcggcacctgg
gtgggcggcgacatggacggcaatcccaatgtggatgccaacaccatcgccggcaccctg
gatgcacaacggcgcgcggtgctggaccgctatcaaaaggaactctggcagctggccagc
ctgctcagtcaatcgaccacgctggtgcaggtgagcccggaactcatgacgcagctggaa
cgctatcgcgcgctgctgcccgacgccgcggcacggtcgcgtccacgtcacggcgacatg
ccgtaccgcctgctcaacgacctgatgcgcgcccgcctgcaggccacactggacgacgcc
gacggcgcctataccgccccttctgaactcgaagacgatctgcagttgatcctggacagc
ctgcaggccaacaagggcctgcacgccggttggttcgccgtgcggcgtctgctgtggcgt
gtgcgcagtttcggtttccatctggcgcggctggacgtgcgccaggaatcgagcgtgcat
gcgcgcgcggtggccgatgccttgggccagaccgactgggacgcgcaggacgcaacccgg
cgcgccgccgtgctcggcccgtatgcctgcgggcaagaagccttgccgcgcgtgcaggat
gaaggcaatgcgcggctggacgcggtattcgccgcgctcgccgatgcacgcacgcgccac
ggtgccgatgcactgggcagctacatcatttcgatggcgcacaaccgcgccgacgtgctc
actgtgctggcgctggcgcgccgcggcggattggtcgacgccgccggcgccgtgccgcta
gatatcgtgccgctgttcgaaaccgtggacgacctgcgcggcggcaccggcacggtgcag
gacctgctggccgacccggtatatcgccagcatctggccgcgcgcggcgatacgcagatg
gtgatgttggggtattcggatagcggcaaggacggcggcatcgccgcctcgcgctggggg
ctgcagcgtgcgcaggtggaactgctggaagccgctgccgatctgggcgtgcggctgacc
ttcttccacggccgtggcggttcgatcgcgcgcggtggcggcaagaccagccgcgcgctg
gacgccgccccgcgcggcagcgtcgatggccgcctgcgcgtcaccgagcagggcgaggtg
atccaccgcaagtacggcatccgtgcattggccttgcgctcgctggagcagatgaccggc
gcggtgttgctttcgagcctgcgcccgcgtgcgcccgagccgcgcgaggcgcgctggcgc
ccggtgatggatctggtggccgaacgcagcaccgtcgcgtatcgcgccttcgtcgccgcg
ccggagttcatgcagtacttccgcctggccacgccgatcgatgtgatcgaacgcatgacg
ctgggctcgcggccctcgcggcggctggggcaggacgcggcgttgtccaacctgcgtgcg
attccgtgggtgttcgcctggagccaggcacgtgcggtgattcccggctggtacggcgtg
ggcagcggcctgcaggcggcggtggatgccgggcatgaagacagcctgcgcgaaatggcg
caggactggccgttcttccgcacctttctggacgatgtcgccatggtgctgtccaagggc
gatctgaatatcgccgagttgttttcgcgcttgtccggcgacttgcacacgcggtttttc
ccgctgattcgcgacgaactggccttgaccaagggctgggtcaaggcactgctgcagcag
cagtcgctgttgcagcacgacccgcggctggcgttgtcgatccgcctgcgcaacccgtac
atcgacccgatcagcgtgctgcaggtagacctgctgcagcgctggcgcgctaccgatggc
gaagacgaagcgctgctgcgcgcgctggtggcctgcgtcaacggcgtctcgcaaggtttg
cagaacactggttga

DBGET integrated database retrieval system