KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_04694Help
Entry
PXO_04694         CDS       T00763                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00620  Pyruvate metabolism
xop00680  Methane metabolism
xop01100  Metabolic pathways
xop01120  Microbial metabolism in diverse environments
xop01200  Carbon metabolism
Module
xop_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PXO_04694 (ppc)
  Energy metabolism
   00680 Methane metabolism
    PXO_04694 (ppc)
Enzymes [BR:xop01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PXO_04694 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ACD57725
UniProt: A0A0K0GHQ8
LinkDB All DBs
Position
1091489..1094179
Genome map
AA seq 896 aa AA seqDB search
MFATPDLPLRDDVRRLGALVGDLLAEQVSAEFLDEIERVRTTAISRRESDAPPSTLSEQL
TGREPRDAEALVRAFSTYFQVVNIAERVHRIRRRREYQRSGTDTPQPDGLHDALRRLKAQ
GVTLDELSQWLPRIDVEPVFTAHPTEAVRRALLEKEQLMVASLVDNLDGMRTPNERTSDA
ARFRMALTASWQTADSSPVRPTVGDEREHVGFYLTQVLYRVIPVMYETLEHAIEETYGSV
PALPRLLRFGTWVGGDMDGNPNVDANTIAGTLDAQRRAVLDRYQRELWQLASLLSQSTTL
VQVSPELMTQLERYRALLPDAAARSRPRHGDMPYRLLNDLMRARLQATLDDADGAYTAPS
ELEDDLQLILDSLQANKGLHAGWFAVRRLLWRVRSFGFHLARLDVRQESSVHARAVADAL
GQTDWDGQDATRRAAVLGPYASGQEALPRAQDEGNARLDAVFAALADARTRHGADALGSY
IISMAHNRADVLTVLALARRGGLVDAAGAVPLDIVPLFETVDDLRGGTGTVQDLLADPVY
RQHLAARGDTQMVMLGYSDSGKDGGIAASRWGLQRAQVELLEAAADLGVRLTFFHGRGGS
IARGGGKTSRALDAAPRGSVDGRLRVTEQGEVIHRKYGIRALALRSLEQMTGAVLLSSLR
PRAPEPREACWRPVMNLVAERSTVAYRAFVGAPEFMQYFRLATPIDVIERMTLGSRPSRR
LGQDAALSNLRAIPWVFAWSQARAVIPGWYGVGSGLQAAVDAGHEDTLREMAQDWPFFRT
FLDDVAMVLSKGDLNIAELFSRLSGDLHTRFFPLIRDELALTKGWVKALLQQQSLLQHDP
RLALSIRLRNPYIDPISVLQVDLLQRWRATDGEDEALLRALVACVNGVSQGLQNTG
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgctacccccgatcttcccttgcgcgacgatgtgcgtcggctcggtgcactggtg
ggtgatctgctcgccgagcaggtgtctgcggaattcctcgatgaaatcgaacgcgtgcgc
accaccgccatctcgcggcgcgaaagcgatgccccgccctccacgttgagcgaacaactc
accgggcgcgagccgcgtgatgccgaagcgctggtgcgcgccttcagtacctatttccag
gtcgtcaatatcgccgagcgcgtgcaccgcatccgccgccgccgcgagtaccagcgcagc
gggaccgacacgccgcagccggatggcctgcacgacgcattgcgtcggctcaaggcgcag
ggggtgacgctggacgaactcagccagtggttgccgcgcatcgatgtggagccggtgttc
accgcgcatcccaccgaggcggtgcgccgcgcgctgctggaaaaagagcagctgatggtc
gccagcctggtcgacaacctggacggcatgcgcacgcccaatgagcgcaccagcgatgcg
gcacgtttccgcatggcgttgaccgcatcgtggcagaccgccgattcctcgcctgtgcgc
cccaccgtgggcgacgagcgcgagcatgtgggcttctatctcacccaggtgctctaccgc
gtcatcccggtgatgtacgaaaccctcgaacacgccatcgaagaaacctatggcagcgtg
ccagccctgccgcgcctgctgcgtttcggcacctgggtgggcggcgacatggacggcaat
cccaatgtggatgccaacaccatcgccggcaccctggatgcacaacggcgcgcggtgctg
gaccgctatcaaagggaactctggcagctggccagcctgctcagtcaatcgaccacgctg
gtgcaggtgagcccggaactcatgacgcagctggaacgctatcgcgcgctgctgccggac
gccgcggcacggtcgcgtccacgtcacggcgacatgccgtaccgactgctcaacgacctg
atgcgcgcccgcctgcaggccacactggacgatgccgacggcgcctataccgccccttct
gaactcgaagacgatctgcagttgatcctggacagcctgcaggccaacaagggcctgcac
gccggttggttcgccgtgcggcgtctgctgtggcgtgtgcgcagtttcggttttcatctg
gcgcggctggacgtgcgccaggaatcgagcgtgcatgcgcgcgcggtggccgatgccttg
ggccagaccgactgggacgggcaggacgcaacccggcgcgccgccgtgctcggcccgtat
gcctccggtcaagaagccttgccgcgcgcgcaggatgaaggcaatgcgcggctggacgcg
gtattcgccgcgctcgccgatgcacgcacgcgccacggtgccgatgcattgggaagctac
atcatttcgatggcgcacaaccgcgccgacgtgctcactgtgctggcgctggcgcgccgc
ggcggattggtcgacgccgccggcgccgtgccgctggatatcgtgccgctgttcgaaacc
gtggacgatctgcgcggcggcaccggcacggtgcaggacctgctggccgacccggtatat
cgccagcatctggccgcgcgcggcgatacgcagatggtgatgttggggtattcggatagc
ggcaaggacggcggcatcgccgcctcgcgctgggggctgcagcgtgcgcaggtggaactg
ctggaagccgctgccgatctgggcgtgcggctgaccttcttccacggccgtggcggttcg
atcgcgcgcggtggcggcaagaccagccgcgcgctggacgccgccccgcgcggcagcgtc
gatggccgcctgcgcgtcaccgagcagggcgaggtgatccaccgcaagtacggcatccgt
gcattggccttgcgctcgctggagcagatgaccggcgcggtgttgctttcgagcctgcgc
ccgcgtgctcccgagccgcgcgaggcgtgctggcgcccggtgatgaatctggtggccgaa
cgcagcaccgtcgcgtatcgcgccttcgtcggcgcgccggagttcatgcagtacttccgc
ctggccacgccgatcgatgtgatcgaacgcatgacgctgggctcgcggccctcgcggcgg
ctggggcaggacgcggcgttgtccaacctgcgtgcgattccgtgggtattcgcctggagc
caggcgcgtgcggtgattcccggctggtacggcgtgggcagcggcctgcaggcggcggtg
gatgccgggcatgaagacaccttgcgcgaaatggcgcaggactggccgttcttccgcacc
tttctggacgatgtcgccatggtgctgtccaagggcgatctgaatatcgccgagttgttt
tcgcgcttgtccggcgacttgcacacgcggtttttcccgctgattcgcgacgaactggcc
ttgaccaagggctgggtcaaggcactgctgcagcagcagtcgctgttgcagcacgacccg
cggctggcgttgtcgatccgcctgcgcaacccgtacatcgacccgatcagcgtgctgcag
gtagacctgctgcagcgctggcgcgctaccgatggcgaagacgaagcgctgctgcgtgcg
ctggtggcctgcgtcaacggcgtctcgcaaggtttgcagaacactggttga

DBGET integrated database retrieval system