KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_04694Help
Entry
PXO_04694         CDS       T00763                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PXO_04694 (ppc)
  Energy metabolism
   00680 Methane metabolism
    PXO_04694 (ppc)
Enzymes [BR:xop01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PXO_04694 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1091489..1094179
Genome map
AA seq 896 aa AA seqDB search
MFATPDLPLRDDVRRLGALVGDLLAEQVSAEFLDEIERVRTTAISRRESDAPPSTLSEQL
TGREPRDAEALVRAFSTYFQVVNIAERVHRIRRRREYQRSGTDTPQPDGLHDALRRLKAQ
GVTLDELSQWLPRIDVEPVFTAHPTEAVRRALLEKEQLMVASLVDNLDGMRTPNERTSDA
ARFRMALTASWQTADSSPVRPTVGDEREHVGFYLTQVLYRVIPVMYETLEHAIEETYGSV
PALPRLLRFGTWVGGDMDGNPNVDANTIAGTLDAQRRAVLDRYQRELWQLASLLSQSTTL
VQVSPELMTQLERYRALLPDAAARSRPRHGDMPYRLLNDLMRARLQATLDDADGAYTAPS
ELEDDLQLILDSLQANKGLHAGWFAVRRLLWRVRSFGFHLARLDVRQESSVHARAVADAL
GQTDWDGQDATRRAAVLGPYASGQEALPRAQDEGNARLDAVFAALADARTRHGADALGSY
IISMAHNRADVLTVLALARRGGLVDAAGAVPLDIVPLFETVDDLRGGTGTVQDLLADPVY
RQHLAARGDTQMVMLGYSDSGKDGGIAASRWGLQRAQVELLEAAADLGVRLTFFHGRGGS
IARGGGKTSRALDAAPRGSVDGRLRVTEQGEVIHRKYGIRALALRSLEQMTGAVLLSSLR
PRAPEPREACWRPVMNLVAERSTVAYRAFVGAPEFMQYFRLATPIDVIERMTLGSRPSRR
LGQDAALSNLRAIPWVFAWSQARAVIPGWYGVGSGLQAAVDAGHEDTLREMAQDWPFFRT
FLDDVAMVLSKGDLNIAELFSRLSGDLHTRFFPLIRDELALTKGWVKALLQQQSLLQHDP
RLALSIRLRNPYIDPISVLQVDLLQRWRATDGEDEALLRALVACVNGVSQGLQNTG
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgctacccccgatcttcccttgcgcgacgatgtgcgtcggctcggtgcactggtg
ggtgatctgctcgccgagcaggtgtctgcggaattcctcgatgaaatcgaacgcgtgcgc
accaccgccatctcgcggcgcgaaagcgatgccccgccctccacgttgagcgaacaactc
accgggcgcgagccgcgtgatgccgaagcgctggtgcgcgccttcagtacctatttccag
gtcgtcaatatcgccgagcgcgtgcaccgcatccgccgccgccgcgagtaccagcgcagc
gggaccgacacgccgcagccggatggcctgcacgacgcattgcgtcggctcaaggcgcag
ggggtgacgctggacgaactcagccagtggttgccgcgcatcgatgtggagccggtgttc
accgcgcatcccaccgaggcggtgcgccgcgcgctgctggaaaaagagcagctgatggtc
gccagcctggtcgacaacctggacggcatgcgcacgcccaatgagcgcaccagcgatgcg
gcacgtttccgcatggcgttgaccgcatcgtggcagaccgccgattcctcgcctgtgcgc
cccaccgtgggcgacgagcgcgagcatgtgggcttctatctcacccaggtgctctaccgc
gtcatcccggtgatgtacgaaaccctcgaacacgccatcgaagaaacctatggcagcgtg
ccagccctgccgcgcctgctgcgtttcggcacctgggtgggcggcgacatggacggcaat
cccaatgtggatgccaacaccatcgccggcaccctggatgcacaacggcgcgcggtgctg
gaccgctatcaaagggaactctggcagctggccagcctgctcagtcaatcgaccacgctg
gtgcaggtgagcccggaactcatgacgcagctggaacgctatcgcgcgctgctgccggac
gccgcggcacggtcgcgtccacgtcacggcgacatgccgtaccgactgctcaacgacctg
atgcgcgcccgcctgcaggccacactggacgatgccgacggcgcctataccgccccttct
gaactcgaagacgatctgcagttgatcctggacagcctgcaggccaacaagggcctgcac
gccggttggttcgccgtgcggcgtctgctgtggcgtgtgcgcagtttcggttttcatctg
gcgcggctggacgtgcgccaggaatcgagcgtgcatgcgcgcgcggtggccgatgccttg
ggccagaccgactgggacgggcaggacgcaacccggcgcgccgccgtgctcggcccgtat
gcctccggtcaagaagccttgccgcgcgcgcaggatgaaggcaatgcgcggctggacgcg
gtattcgccgcgctcgccgatgcacgcacgcgccacggtgccgatgcattgggaagctac
atcatttcgatggcgcacaaccgcgccgacgtgctcactgtgctggcgctggcgcgccgc
ggcggattggtcgacgccgccggcgccgtgccgctggatatcgtgccgctgttcgaaacc
gtggacgatctgcgcggcggcaccggcacggtgcaggacctgctggccgacccggtatat
cgccagcatctggccgcgcgcggcgatacgcagatggtgatgttggggtattcggatagc
ggcaaggacggcggcatcgccgcctcgcgctgggggctgcagcgtgcgcaggtggaactg
ctggaagccgctgccgatctgggcgtgcggctgaccttcttccacggccgtggcggttcg
atcgcgcgcggtggcggcaagaccagccgcgcgctggacgccgccccgcgcggcagcgtc
gatggccgcctgcgcgtcaccgagcagggcgaggtgatccaccgcaagtacggcatccgt
gcattggccttgcgctcgctggagcagatgaccggcgcggtgttgctttcgagcctgcgc
ccgcgtgctcccgagccgcgcgaggcgtgctggcgcccggtgatgaatctggtggccgaa
cgcagcaccgtcgcgtatcgcgccttcgtcggcgcgccggagttcatgcagtacttccgc
ctggccacgccgatcgatgtgatcgaacgcatgacgctgggctcgcggccctcgcggcgg
ctggggcaggacgcggcgttgtccaacctgcgtgcgattccgtgggtattcgcctggagc
caggcgcgtgcggtgattcccggctggtacggcgtgggcagcggcctgcaggcggcggtg
gatgccgggcatgaagacaccttgcgcgaaatggcgcaggactggccgttcttccgcacc
tttctggacgatgtcgccatggtgctgtccaagggcgatctgaatatcgccgagttgttt
tcgcgcttgtccggcgacttgcacacgcggtttttcccgctgattcgcgacgaactggcc
ttgaccaagggctgggtcaaggcactgctgcagcagcagtcgctgttgcagcacgacccg
cggctggcgttgtcgatccgcctgcgcaacccgtacatcgacccgatcagcgtgctgcag
gtagacctgctgcagcgctggcgcgctaccgatggcgaagacgaagcgctgctgcgtgcg
ctggtggcctgcgtcaacggcgtctcgcaaggtttgcagaacactggttga

DBGET integrated database retrieval system