KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_0872Help
Entry
XOC_0872          CDS       T01873                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    XOC_0872 (ppc)
  Energy metabolism
   00680 Methane metabolism
    XOC_0872 (ppc)
Enzymes [BR:xor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     XOC_0872 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
879039..881729
Genome map
AA seq 896 aa AA seqDB search
MFATPDLPLRDDVRRLGALVGDLLAEQVSAEFLDEIERVRTTAISRRESDAPPSTLSEQL
TGREPRDAEALVRAFSTYFQVVNIAERVHRIRRRREYQRSGTDTPQPDGLHDALRRLKAQ
GVTLDELSQWLPRIDVEPVFTAHPTEAVRRALLEKEQLMVASLVDNLDGMRTPNERTSDA
ARFRMALTASWQTADSSPVRPTVGDEREHVGFYLTQVLYRVIPVMYETLEHAIEETYGSV
PALPRLLRFGTWVGGDMDGNPNVDANTIAGTLDAQRRAVLDRYQKELWQLASLLSQSTTL
VQVSPELMTQLERYRALLPDAAARSRPRHGDMPYRLLNDLMRARLQATLDDADGAYTAPS
ELEDDLQLILDSLQANKGLHAGWFAVRRLLWRVRSFGFHLARLDVRQESSVHARAVADAL
GQTDWDGQDATRRAAVLGPYACGQEALPRAQDEGNARLDAVFAALADARTRHGADALGSY
IISMAHNRADVLTVLALARRGGLVDAAGTVPLDIVPLFETVDDLRGGTGTVQDLLADPVY
RQHLAARGDTQMVMLGYSDSGKDGGIAASRWGLQRAQVELLEAAADLGVRLTFFHGRGGS
IARGGGKTSRALDAAPRGSVDGRLRVTEQGEVIHRKYGIRALALRSLEQMTGAVLLSSLR
PRAPEPREARWRPVMDLVAERSTVAYRAFVAAPEFMQYFRLATPIDVIERMTLGSRPSRR
LGQDAALSNLRAIPWVFAWSQARAVIPGWYGVGSGLQAAVDAGHEDTLREMAQDWPFFRT
FLDDVAMVLSKGDLNIAELFSRLSGDLHTRFFPLIRDELALTKGWVKALLQQQSLLQHDP
RLALSIRLRNPYIDPISVLQVDLLQRWRATDGEDEALLRALVACVNGVSQGLQNTG
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgctacccccgatcttcccttgcgcgacgatgtgcgtcggctcggtgcactggtg
ggtgatctgctcgccgagcaggtgtctgcggaattcctcgatgaaatcgaacgcgtgcgc
accaccgccatctcgcggcgcgaaagcgatgccccgccctccacgttgagcgaacaactc
accgggcgcgagccgcgtgatgccgaagcgctggtgcgcgccttcagtacctatttccag
gtcgtcaatatcgccgagcgcgtgcaccgcatccgccgccgccgcgagtaccagcgcagc
ggtaccgacaccccgcagccggatggcctgcacgacgcattgcgtcggctcaaggcgcag
ggcgtgacgctggacgaactcagccagtggttgccgcgcatcgatgtggagccggtgttc
accgcgcatcccaccgaggcggtgcgccgcgcgctgctggaaaaagagcagctgatggtc
gccagcctggtcgacaacctggacggcatgcgcacgcccaatgagcgcaccagcgatgcg
gcacgtttccgcatggcgttgaccgcttcgtggcagaccgccgattcctcgccggtgcgc
cccaccgtgggcgacgagcgcgagcatgtgggcttctatctcacccaggtgctctaccgc
gtcatcccggtgatgtacgaaaccctcgaacacgccatcgaagaaacctatggcagcgtg
ccagccctgccgcgcctgctgcgtttcggcacctgggtgggcggcgacatggacggcaat
cccaatgtggatgccaacaccatcgccggcaccctggatgcacaacggcgcgcggtgctg
gaccgctatcaaaaggaactctggcagctggccagcctgctcagtcaatcgaccacgctg
gtgcaggtgagcccggaactcatgacgcagctggaacgctatcgcgcgctgctgcccgac
gccgcggcacggtcgcgtccacgtcacggcgacatgccgtaccgcctgctcaacgacctg
atgcgcgcccgcctgcaggccacactggacgatgccgacggtgcctataccgccccctct
gaactcgaagacgatctgcagttgatcctggacagcctgcaggccaacaagggcctgcac
gccggttggttcgccgtgcggcgtctgctgtggcgtgtgcgcagtttcggttttcatctg
gcgcggctggacgtgcgccaggaatcgagcgtgcatgcgcgcgcggtggccgatgccttg
ggccagaccgactgggacgggcaggacgcaacccggcgcgccgccgtgctcggcccgtat
gcctgcgggcaagaagccttgccgcgcgcgcaggatgaaggcaatgcgcggctggacgcg
gtattcgccgcgctcgccgatgcacgcacgcgccacggtgccgatgcactgggcagctac
atcatttcgatggcgcacaaccgcgccgacgtgctcactgtgctggcgctggcgcgccgc
ggcggattggtcgacgccgccggcaccgtgccgctggatatcgtgccgctgttcgaaacc
gtggacgatctgcgcggcggcaccggcacggtgcaggacctgctggccgacccggtgtat
cgccagcatctggccgcgcgcggcgatacgcagatggtgatgttggggtattcggatagc
ggcaaggacggcggcatcgccgcctcgcgctgggggctgcagcgtgcgcaggtggaactg
ctggaagccgctgccgatctgggcgtgcggctgaccttcttccacggccgtggcggttcg
atcgcgcgcggtggcggcaagaccagccgcgcgctggacgccgccccgcgcggcagcgtc
gatggccgcctgcgcgtcaccgagcagggcgaggtgatccaccgcaagtacggcatccgt
gcattggccttgcgctcgctggagcagatgaccggcgcggtgttgctttcgagcctgcgc
ccgcgtgcgcccgagccgcgcgaagcgcgctggcgtccggtgatggatctggtggccgaa
cgcagcaccgtcgcttatcgcgccttcgtcgccgcgccggagttcatgcagtacttccgc
ctggccacgccgatcgatgtgatcgaacgcatgacgctgggctcgcggccctcgcggcgg
ctggggcaggacgcggcgttgtccaacctgcgtgcgattccgtgggtgttcgcctggagc
caggcgcgtgcggtgattcccggctggtacggcgtgggcagcggcctgcaggcggcggtg
gatgccgggcatgaagacaccttgcgcgaaatggcgcaggactggccgttcttccgcacc
tttctggacgatgtcgccatggtgctgtccaagggcgatctgaatatcgccgagttgttt
tcgcgcttgtccggcgacttgcacacgcggtttttcccgctgattcgcgacgaactggcc
ttgaccaagggctgggtcaaggcactgctgcagcagcagtcgctgttgcagcacgacccg
cggctggcgttgtcgatccgcctgcgcaacccgtacatcgacccgatcagcgtgctgcag
gtagacctgctgcagcgctggcgcgctaccgatggcgaagacgaagcgctgctgcgcgcg
ctggtggcctgcgtcaacggcgtctcgcaaggtttgcagaacactggttga

DBGET integrated database retrieval system