KEGG   Xanthomonas oryzae pv. oryzae PXO86: AZ54_04935Help
Entry
AZ54_04935        CDS       T03765                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
xoy  Xanthomonas oryzae pv. oryzae PXO86
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:xoy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZ54_04935
  Energy metabolism
   00680 Methane metabolism
    AZ54_04935
Enzymes [BR:xoy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AZ54_04935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1014727..1017441
Genome map
AA seq 904 aa AA seqDB search
MNEYRSSLVFATPDLPLRDDVRRLGALVGDLLAEQVSAEFLDEIERVRTTAISRRESDAP
PSTLSEQLTGREPRDAEALVRAFSTYFQVVNIAERVHRIRRRREYQRSGTDTPQPDGLHD
ALRRLKAQGVTLDELSQWLPRIDVEPVFTAHPTEAVRRALLEKEQLMVASLVDNLDGMRT
PNERTSDAARFRMALTASWQTADSSPVRPTVGDEREHVGFYLTQVLYRVIPVMYETLEHA
IEETYGSVLALPRLLRFGTWVGGDMDGNPNVDANTIAGTLDAQRRAVLDRYQKELWQLAS
LLSQSTTLVQVSPELMTQLERYRALLPDAAARSRPRHGDMPYRLLNDLMRARLQATLDDA
DGAYTAPSELEDDLQLILDSLQANKGLHAGWFAVRRLLWRVRSFGFHLARLDVRQESSVH
ARAVADALGQTDWDGQDATRRAAVLGPYACGQEALPRAQDEGNARLDAVFAALADARTRH
GADALGSYIISMAHNRADVLTVLALARRGGLVDAAGTVPLDIVPLFETVDDLRGGTGTVQ
DLLADPVYRQHLAARGDTQMVMLGYSDSGKDGGIAASRWGLQRAQVELLEAAADLGVRLT
FFHGRGGSIARGGGKTSRALDAAPRGSVDGRLRVTEQGEVIHRKYGIRALALRSLEQMTG
AVLLSSLRPRAPEPREARWRPVMDLVAERSTVAYRAFVAAPEFMQYFRLSTPIDVIERMT
LGSRPSRRLGQDAALSNLRAIPWVFAWSQARAVIPGWYGVGSGLQAAVDAGHEDTLREMA
QDWPFFRTFLDDVAMVLSKGDLNIAELFSRLSGDLHTRFFPLIRDELALTKGWVKALLQQ
QSLLQHDPRLALSIRLRNPYIDPISVLQVDLLQRWRATDGEDEALLRALVACVNGVSQGL
QNTG
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagtaccgcagcagtcttgtgttcgctacccccgatcttcccttgcgcgacgat
gtgcgtcggctcggtgcactggtgggtgatctgctcgccgagcaggtgtctgcggaattc
ctcgatgaaatcgaacgcgtgcgcaccaccgccatctcgcggcgcgaaagcgatgccccg
ccctccacgttgagcgaacaactcaccgggcgcgagccgcgtgatgccgaagcgctggtg
cgcgccttcagtacctatttccaggtcgtcaatatcgccgagcgcgtgcaccgcatccgc
cgccgccgcgagtaccagcgcagcggtaccgacacgccgcagccggatggcctgcacgac
gcattgcgtcggctcaaggcgcagggcgtgacgctggacgaactcagccagtggttgccg
cgcatcgatgtggagccggtgttcaccgcgcatcccaccgaggcggtgcgccgcgcgctg
ctggaaaaagagcagctgatggtcgccagcctagtcgacaacctggacggcatgcgcacg
cccaatgagcgcaccagcgatgcggcacgtttccgcatggcgttgaccgcttcgtggcag
accgccgattcctcgccggtgcgccccaccgtgggcgacgagcgcgagcatgtgggcttc
tatctcacccaggtgctctaccgcgtcatcccggtgatgtacgaaaccctcgaacacgcc
atagaagaaacctatggcagcgtgctagccctgccgcgcctgctgcgtttcggcacctgg
gtgggcggcgacatggacggcaatcccaatgtggatgccaacaccatcgccggcaccctg
gatgcacaacggcgcgcggtgctggaccgctatcaaaaggaactctggcagctggccagc
ctgctcagtcaatcgaccacgctggtgcaggtgagcccggaactcatgacgcagctggaa
cgctatcgcgcgctgctgccggacgccgcggcacggtcgcgtccacgtcacggcgacatg
ccgtaccgcctgctcaacgacctgatgcgcgcccgcctgcaggccacactggacgatgcc
gacggcgcctataccgccccctctgaactcgaagacgatctgcagttgatcctggacagc
ctgcaggccaacaagggcctgcacgccggttggttcgccgtgcggcgtctgctgtggcgt
gtgcgcagtttcggtttccatctggcgcggctggacgtgcgccaggaatcgagcgtgcat
gcgcgcgcggtggccgatgctttgggccagaccgactgggacgggcaggacgcaacccgg
cgcgccgccgtgctcggcccgtatgcctgcgggcaagaagccttgccgcgcgcgcaggat
gaaggcaatgcgcggctggacgcggtattcgccgcgctcgccgatgcacgcacgcgccac
ggtgccgatgcactgggcagctacatcatttcgatggcgcacaaccgcgccgacgtgctc
actgtgctggcgctggcgcgccgcggcggattggtcgacgccgccggcaccgtgccgctg
gatatcgtgccgctgttcgaaaccgtggacgatctgcgcggcggcaccggcacggtgcag
gacctgctggccgacccggtgtatcgccagcatctggccgcgcgcggcgatacgcagatg
gtgatgttggggtattcggatagcggcaaggacggcggcatcgccgcctcgcgctggggg
ctgcagcgtgcgcaggtggaactgctggaagccgctgccgatctgggcgtgcggctgacc
ttcttccacggccgtggcggttcgatcgcgcgcggtggcggcaagaccagccgcgcgctg
gacgccgccccgcgcggcagcgtcgatggccgcctgcgcgtcaccgagcagggcgaggtg
atccaccgcaagtacggcatccgtgcattggccttgcgctcgctggagcagatgaccggc
gcggtgttgctttcgagcctgcgcccgcgtgcgcccgagccgcgcgaggcgcgctggcgt
ccggtgatggatctggtggccgaacgcagcaccgtcgcctatcgcgccttcgtcgccgcg
ccggagttcatgcagtacttccgcctgtccacgccgatcgatgtgatcgaacgcatgacg
ctgggctcgcggccctcgcggcggctggggcaggacgcggcgttgtccaacctgcgtgcg
attccgtgggtgttcgcctggagccaggcgcgtgcggtgattcccggctggtacggcgtg
ggcagcggcctgcaggcggcggtggatgccgggcatgaagacaccttgcgcgaaatggcg
caggactggccgttcttccgcacctttctggacgatgtcgccatggtgctgtccaagggc
gatctgaatatcgccgagttgttttcgcgcttgtccggcgacttgcacacgcggtttttc
ccgctgattcgcgacgaactggccttgaccaagggctgggtcaaggcactgctgcagcag
cagtcgctgttgcagcacgacccgcggctggcgttgtcgatccgcctgcgcaacccgtac
atcgacccgatcagcgtgctgcaggtagacctgctgcagcgctggcgcgctaccgatggc
gaagacgaagcgctgctgcgcgcgctggtggcctgcgtcaacggcgtctcgcaaggtttg
cagaacactggttga

DBGET integrated database retrieval system