KEGG   Xanthomonas oryzae pv. oryzae PXO86: AZ54_06030Help
Entry
AZ54_06030        CDS       T03765                                 

Definition
(GenBank) peptidase M20
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
xoy  Xanthomonas oryzae pv. oryzae PXO86
Brite
Enzymes [BR:xoy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     AZ54_06030
Peptidases [BR:xoy01002]
 Metallo Peptidases
  Family M2
   AZ54_06030
Exosome [BR:xoy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AZ54_06030
CD molecules [BR:xoy04090]
 Proteins
  AZ54_06030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1208352..1210370)
Genome map
AA seq 672 aa AA seqDB search
MNPRLLLLALAVAVGTLSLSACRRDAAPPAKPVATKTAPAESADQFVARISAQYKAAYPE
TTAAQWLSSTYINGDSQLLAAKANERSLAQLDRWIEQSKQYAGTPMSADSARALQLLKLM
SALPAPRDAAKLAELTRIAAKMEGDYGAGSYCVGEGEQRRCRQLGELEQVLASSRDYNEQ
LDAWQGWHSTARPMRKDYQRFVELANEGARGFGFADVGVLWRSGYDMPPAQLASETDRLW
EQVKTLYVQLQCYARGKLDTQYGKDKGEVPGGLLPAHLMGNMWQQDWSNLWDLLQPYPGA
GDLDITSALEKQYQGNLTAVLARNTGGVGGATARFNAEHEAQLRTAKQMTERAQEFYTSL
GMPKLPDTYWQRSQFIKPLDRDVVCHASAWDMNMGGEANQNIGADVRTKMCIQPTEEDFT
TIYHELGHLYYDLAYKPLPPLFQNGANDGFHEAIGDTIVLAMTPKYLQSIGMVGEQRTGR
EALINWQMRMALSKVAFLPFGLMIDRWRWGVFDGSITPEHYNQAWWELKAKYQGVAPVSA
RGEDFFDPGAKYHVPGNTPYTRYFLAHILQFQFYKSLCQAAGHQGPLYECSFYGNKDAGQ
KFWSMLQRGSSQPWQTTLKELTGNDKLDAGPMLEYFAPMSEWLKQQNQGQMCGWQAAAAA
PASTTTAPAAPR
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcctcgtttgctgttgctggcgttggctgtggctgtcggcaccctgagcttgtcg
gcctgccgccgggatgcggcaccgccggccaaacccgtcgcgaccaagaccgcgccggcg
gagagcgccgaccagttcgttgcgcgcatcagcgcccaatacaaggcggcctatccggaa
accaccgccgcgcagtggctgtcgtcgacctatatcaacggcgattcgcaattgctcgcg
gccaaggccaacgagcgctcgctggcgcagctggatcgctggatcgaacaatccaagcag
tacgccggcacaccgatgtcagccgacagcgcgcgcgcgctgcagttgctgaaattgatg
agcgccctgcccgcaccgcgcgatgcggccaaactcgccgaactcacccgcatcgccgcc
aagatggaaggcgactacggcgccggcagttactgcgtgggcgaaggcgaacagcgccgc
tgccgccagctcggcgaactggaacaagtattggccagcagccgcgactacaacgaacaa
ctcgacgcctggcagggctggcacagcaccgcacggccgatgcgcaaggattaccaacgc
ttcgtcgagctcgccaacgaaggcgcgcgcggattcggcttcgccgacgtcggggtgttg
tggcgcagtggctacgacatgccgccggcgcaactggccagcgaaaccgaccgcctgtgg
gaacaggtcaaaacgctgtacgtgcagttgcagtgctatgcgcgcggcaaactcgatacg
caatacggcaaggacaagggcgaggtgcctggcggtctgctgcctgcacatctgatgggc
aatatgtggcagcaggactggagcaatctgtgggatctgctgcagccctaccccggggcc
ggcgatctggacattacctccgcgctggaaaaacagtaccagggcaacctcaccgcagtg
ctggcacgcaacaccggtggcgttggtggcgcgaccgcacgcttcaacgccgagcacgaa
gcgcagctgcgcaccgccaagcagatgaccgagcgcgcgcaggagttctacacatcgctg
ggcatgcccaagctgccggacacctattggcagcgctcgcagttcatcaagccgctggac
cgcgatgtggtgtgccacgccagcgcctgggatatgaacatgggtggcgaggcgaaccag
aacatcggcgcggacgtgcgcaccaagatgtgcatccaaccgaccgaagaagacttcacc
accatctaccacgagctcggccacctctattacgacctggcctacaagcccttgccgccg
ctgtttcagaacggcgccaacgatgggtttcacgaggcgatcggcgacaccatcgtgctg
gcgatgacgcccaagtacctgcagtcgatcggcatggtgggcgagcaacggaccggccgc
gaggcgttgatcaattggcagatgcgcatggcgctgagcaaggtggcgttcctgccgttc
ggtttgatgatcgaccgctggcgctggggcgtgttcgatggctccatcacgcccgagcat
tacaaccaggcctggtgggaactgaaagcaaagtaccagggcgtggcgccggtgagcgcg
cgcggcgaagacttcttcgaccctggcgccaagtaccacgtgccgggcaacacgccgtac
acgcgctattttctggcgcatatcctgcaattccagttctacaaaagcctgtgccaggcc
gctggccatcagggcccgctttacgaatgcagcttctacggcaacaaggatgccgggcag
aagttctggtcgatgctgcaacgtggttccagccaaccctggcaaaccacactgaaggaa
ctcaccggcaacgacaaactcgatgccggcccgatgctggaatatttcgcgccaatgagc
gaatggctgaagcagcagaatcaggggcagatgtgtgggtggcaggcagcggctgccgct
ccagctagcacgacaactgcgcctgctgcgccgcgctga

DBGET integrated database retrieval system