KEGG   Xenopus tropicalis (western clawed frog): 100125163Help
Entry
100125163         CDS       T01011                                 

Gene name
amy2a
Definition
(RefSeq) amylase, alpha 2A (pancreatic)
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00500  Starch and sucrose metabolism
xtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100125163 (amy2a)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100125163 (amy2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 100125163
NCBI-ProteinID: XP_002938902
Xenbase: XB-GENE-968629
LinkDB All DBs
Position
4
AA seq 511 aa AA seqDB search
MKVLLLLVAIGLCSAQYNPNTQSGRTSIVHLFEWRWDDIAAECERYLGPNGFGGVQISPP
NEHIIVTNPYRPWWERYQPISYKLCSRSGNEQQFRDMVTRCNNVGVYIYVDAVINHMCGS
GGGAGTHSSCGSYFNAGSREFPVPYSSWDFNDGKCRTGSGEIENYSDANQVRDCRLVGLL
DLALEKDYVRGKIAEFMNNLINIGVAGFRLDAAKHMWPGDLKAISERLNNLNTKWFPAGA
RPFIFQEVIDLGGEAISVNEYYGIGRVTEFKYGAKLGTVIRKWNGEKLSYLRNWGEGWGF
MPNDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMGVGFMLAHPYGFTRVMSSFRWSR
NIVNGKDQNDWIGPPSNSDGSTKSVPINPDSTCGDNWVCEHRWRQIKNMVTFRNVADGQP
FSNWWDNGSNQVAFGRGNKGFIIFNNDDWQLDVTLNTGLPSGTYCDVISGQKEGSRCTGR
QINVDGNGYAKFQISNNDEDPFAAIHVNAKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtccttctactcttggtggctattgggctctgctcagcccaatataatcctaac
actcaatctggacgaacatccattgtgcacctgtttgaatggagatgggacgatattgca
gcagaatgtgaacggtatttgggaccaaatggctttggaggtgttcagatttcaccccca
aatgaacacattattgtgacaaacccttatagaccttggtgggagaggtaccagcctata
agttacaagctctgcagtcgttctgggaatgagcaacagtttagagacatggtgacaaga
tgtaacaatgttggcgtatatatttacgtggatgccgtaattaaccatatgtgtggctca
ggtggaggtgctgggactcattcatcttgcggcagctacttcaatgcaggatccagggag
ttcccagttccctattctagctgggattttaatgatggaaagtgcaggactggcagtggt
gaaatagaaaactattcggatgctaaccaggtccgagactgtcgtcttgtcggtcttctt
gatttggcactggagaaagactatgttcgtggaaagattgctgaattcatgaacaatctt
attaacattggggttgctggattccgactggatgctgctaagcatatgtggcctggggac
ctaaaggctatttcagaaagactcaataatctcaatacaaaatggttccctgctggagct
cgacctttcatcttccaagaggtaattgatcttgggggtgaagcaatttctgtcaacgaa
tactatggaatcggacgagttactgagttcaagtatggtgccaagcttgggacagtcatc
cgcaaatggaatggagaaaagttgtcctacctaaggaactggggagaaggctggggattc
atgcctaatgacagagccttggtgtttgttgacaatcatgataatcagagaggacacggt
gctggaggagcttccatactcaccttctgggatgcacgtctgtacaaaatgggagttggc
ttcatgctggcacatccttatggttttactcgtgtcatgtctagcttcagatggtctagg
aacatagtcaatggaaaggatcaaaatgactggattggccctcctagtaattccgatgga
tccaccaaatcagtcccaatcaaccctgactcaacatgtggtgacaactgggtctgtgag
catagatggcgtcagattaagaacatggttaccttccgtaatgtagcagatggtcaaccc
ttctcaaactggtgggataatgggagcaaccaagttgcatttggacgtggcaataaagga
ttcataatctttaataatgatgattggcaattggatgtcactctgaatactggccttcca
agtggaacctactgtgatgtgatctctggacagaaggagggatctcgctgcacaggcagg
cagatcaatgtggatggcaatggctatgctaaattccaaataagcaacaacgacgaagac
ccattcgctgctattcatgtaaatgccaaattataa

DBGET integrated database retrieval system