KEGG   Xenopus tropicalis (western clawed frog): 100170618Help
Entry
100170618         CDS       T01011                                 

Gene name
tgm2, g-alpha-h, gnah, tg2, tgc, tgm2-a, tgm2-b
Definition
(RefSeq) transglutaminase 2
  KO
K05625  
transglutaminase 2 [EC:2.3.2.13]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100170618 (tgm2)
Cell adhesion molecules and their ligands [BR:xtr04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     100170618 (tgm2)
   VLA-5
     100170618 (tgm2)
   VLA-9
     100170618 (tgm2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
UniProt: 
LinkDB All DBs
Position
10
AA seq 691 aa AA seqDB search
MAEELYLESFDLDCSGNNRSHRTAEATCERLIVRRGQPFQITLNFSPRGYEEGVDKLSLN
AVTGPCPSEESGTSNHIPVSDALQDGAWSAAITSTDGGTLILSITSPPDARIGYYNLSLE
TSTEYQGSSFQLGSFTLLFNPWCPEDSVYLETEEERKEYVLCQHGIIFQGTKDSVEHVPW
NFGQFEDEILDITLQVLDTSPKFLNDSNRDCSRRNDPVYISRVISAMVNCNDDRGVLFGR
WDNKYDDGISPMFWMGSVAILRRWRKFSCQAVKYGQCWVYAAVACTVLRCLGIPARVITN
YNSAHDTNSNLLIEQYLDEHGKRQPKQKEIIWNYHCWTEAWMTRPDLGEAYNGWQVVDPT
PQEKSEGTYCCGPTPVKAVKEGDLNLKYDVPFVFAEVNADVVYFVQQNDGSVKKTQFISL
VGQKISTKAIGKDEREDITLNYKYPEGSEDERRVFEKANKQSEAEEERVETPSDFTIKIK
VSEGMNKGSDFDVFAVITNNREEEKQCRLMFCARTCSYTGEVGPECGMKDLLNLTLTPQE
EKRVPLRILYEKYGPTMTENNTIKLVAMLYDYSSKEIILAVRDIHVKNPSIKIKVLGEPK
QKRKLVAEISLKNPLAEPLTGCCFTVEGAGLTAEQLVKTLDCPVEPGQEAKVRVDLMPQL
AGKLSLVVDFESDLLKAVKGYRNIIIAPLPK
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagaactgtatctagagagctttgacctggactgtagcggaaataaccgcagt
caccgaaccgcagaagccacctgtgagcgcctgattgtccgaagagggcagccctttcaa
ataaccctcaacttttccccacggggttatgaagaaggggtggataaattgtcgctcaat
gctgtaacaggtccatgtccctcggaagaatcaggcaccagtaaccacatcccagtctca
gatgctctgcaagatggagcatggagcgcagctattaccagcaccgatggcggcacactc
atcctttctatcacctcacccccggatgcccgcattggctactataacctctccctggag
acctccactgaataccaaggctccagctttcagcttggaagtttcactctgctgtttaac
ccttggtgcccagaggattctgtctacttggagactgaagaggaaaggaaagaatatgtg
ctatgccagcatgggatcattttccaagggacaaaggactcagttgaacatgttccctgg
aattttggacagtttgaagatgagattctggacatcactctccaggttttagataccagc
cctaagttcctaaatgactccaaccgtgactgctccagacggaatgacccggtttatatc
agtcgtgtgattagtgccatggtgaactgtaatgatgacagaggggttctctttggacgc
tgggataacaaatatgatgatggcatcagccccatgttttggatgggcagtgttgcaatc
ctacgccgctggaggaaattcagttgccaggcagtgaaatatggccagtgttgggtgtat
gctgccgtggcatgtacagtattacggtgcctggggattccagcccgggtaatcactaac
tacaactcagcccatgacactaacagcaacctcctgattgagcagtacctggatgagcac
ggaaagcggcagcccaagcagaaagaaataatctggaactatcactgttggactgaggca
tggatgacacgtccagatttgggcgaggcttacaatggatggcaggttgtggatccaaca
ccacaggagaaaagtgaaggaacctactgctgtggaccaactcctgtgaaagctgttaag
gaaggagacctaaatctgaagtatgacgtcccctttgtttttgccgaggtaaatgcagat
gtggtctattttgtacagcagaacgacggatctgtcaagaaaacccaatttatttcactg
gtgggtcagaagatcagtactaaagcaatcggaaaagatgaacgggaagacataacgctc
aactacaagtaccccgaaggctcagaagatgaaagacgtgtgtttgagaaagccaataaa
caatctgaagcagaagaagaaagagttgaaactccttctgatttcactatcaagattaaa
gtctctgaagggatgaacaaaggttctgactttgatgtttttgctgtcatcaccaacaac
agagaggaggagaaacagtgccgcctcatgttctgcgcccgcacttgcagctacactggg
gaggtggggccagagtgtggcatgaaggaccttctcaatctcacattgacaccccaagaa
gagaagagagtgcctctgcgtatcctatatgagaagtatggccccacaatgactgagaac
aacacgatcaagctggtagccatgctgtacgactactcatctaaggagattatcctggct
gtgagagacatccatgtaaagaatccaagcatcaaaataaaggttctgggggagccaaag
cagaagagaaagctggtggctgagatctccctaaagaaccctctggcggagccattaaca
ggctgctgcttcactgtggagggggctgggctgacggcagaacaactggtcaaaacactt
gattgcccagtggagcctgggcaggaagccaaggtgagggttgatctgatgccccagcta
gccggtaagctctctctggttgtggatttcgagagcgacctcctgaaggctgtgaaaggc
tacaggaacatcatcattgcgccccttccaaagtga

DBGET integrated database retrieval system