KEGG   Xenopus tropicalis (western clawed frog): 100486682Help
Entry
100486682         CDS       T01011                                 

Gene name
tgm5
Definition
(RefSeq) transglutaminase 5
  KO
K05622  
transglutaminase 5 [EC:2.3.2.13]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100486682 (tgm5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
LinkDB All DBs
Position
10
AA seq 692 aa AA seqDB search
MTAEIAYSDFQIKRNNKAHHTDETGDRRLFIRRGQPFFITVHFKTRGFQPGQDNVIFLVE
TDDDVFMGNEAERQEYVINDYGFVYQGNHNWIIPCAWNFGQFEDDIVDISLKILDKNLNY
IQDSFKDLKNRNNPVYISRVICAMINSNDDNGVLQGNWSGDYTNGVSPSAWNGSILILRQ
WYKSDCQPVKYGQCWVFAAVMCTVMRCLGIPARVVTNFDSAHDTDQNLLIDEYYDTTGKK
LSKETKDSIWNFHVWCECWMARRDLPPGYGGWQVLDPTPQEASNGIFVCGPASVKAIREG
DIHLNYDAPFVFAMVNADCVSWIVSTKGKEKYHCDPHLVGTQISTKRAGSDEREDLTHQY
KYEEGINETAEERKAFEKAISRLHKGGAIPNINESEHMNGANGTSANGITPSPDESSRYT
PQNENSNLNSPLREALLLLKFKLTESPQLGETISLVLLAGNMVSTAKTLKLSLSAQAMKH
DGKPAQQFWRDSMYVELGPHEAQTNSLWIVIELPKSLCKVTIPFIPFQLTQENEEGNLSP
MFFYTEKWLLFKIPYAKYGPSLEDNHLIRFIAVGEQNITWEKVLVEKDVNLALPAVVINF
LELAVVDKTCKAELSFSNPINEAIHDCQILIQGSGLLKKQVKLNMGTMKPGQKAVVAFEF
VPWKVGYKQLQVNISSNRFKGLKGFKSVVVKP
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagagattgcatattcagattttcaaatcaaaagaaataataaagcccaccat
acagatgaaactggggacagacgcctatttattagaagaggacaaccgttttttatcacc
gttcacttcaaaacaaggggctttcagccaggacaggacaatgtcattttccttgtggaa
acagatgatgatgtgttcatgggaaatgaagcagaaaggcaggagtatgtcataaacgat
tatggatttgtttatcaaggaaaccataactggataatcccctgcgcttggaactttgga
cagtttgaagatgacattgtggatattagcctaaagattttagacaagaatttaaactac
attcaagattcatttaaagatttaaaaaataggaataaccctgtgtatatcagcagagtc
atctgtgctatgatcaacagtaatgatgacaatggggtgttacaaggaaactggtctggg
gactatacaaatggtgtctccccatctgcctggaatggaagcatactcattttgagacaa
tggtataaaagtgactgtcaacctgtgaaatatggacagtgctgggtatttgccgctgtt
atgtgcacagtgatgagatgtttaggaatccctgcccgggttgtgaccaactttgactcg
gctcacgacaccgaccagaacctgctaattgatgaatactatgatacaactggaaagaaa
ttaagtaaagaaactaaagacagcatttggaacttccatgtgtggtgtgaatgttggatg
gcacgtagagacttacctccaggatacggagggtggcaggtgcttgaccccactccacag
gaggcaagcaatgggatctttgtctgtggtcctgcttcagttaaagctatccgagaggga
gacatacacctcaactatgatgctccatttgtctttgccatggtgaatgcagactgtgtg
tcctggatagtcagcacaaaaggaaaagagaagtatcactgtgatccgcatttagttgga
acccaaattagcacaaaacgtgccggcagtgatgagcgtgaagatctgacccatcaatat
aagtatgaagaaggtattaatgaaacagctgaagaaaggaaagcgtttgagaaggccatc
agccgactgcacaagggaggtgcgattccaaacatcaatgagagtgagcatatgaatgga
gctaatggaacatcagccaatggtatcactccttcccctgatgaatcttctagatacaca
cctcaaaatgaaaattcaaatcttaatagccccctgagagaggctttactgttgttaaag
tttaaattgaccgaatctccccagcttggagaaaccatcagtttggtgttactggctgga
aatatggtctccactgccaaaaccttaaagttgtccttgagtgcccaggctatgaaacat
gatggcaaaccagctcagcagttctggagggactctatgtatgtggaacttgggccacat
gaagcacaaactaacagcctttggatagtcatagaactgccaaagtctctatgtaaggtc
accattccatttattccctttcagctgactcaggagaatgaagaaggtaatttgtctcca
atgttcttttatacagagaaatggcttttgttcaaaatcccttatgcaaaatatggaccc
tccctagaagacaaccatttgatccgatttattgccgttggagaacaaaacattacctgg
gagaaggttctagtggaaaaagatgttaacttggctttacctgcagtggttattaatttt
cttgaacttgctgttgtggacaagacatgtaaagcggagctctccttttctaaccccatt
aatgaggcgatacatgactgtcagatcctgattcagggcagcggattgctgaaaaaacaa
gtaaaattaaacatgggcaccatgaagccaggacagaaggcagtggtggcgtttgagttt
gttccatggaaagtgggctacaagcagctacaggtgaacatcagcagcaaccgcttcaag
ggactcaaaggttttaagagtgtggtggttaaaccttga

DBGET integrated database retrieval system