KEGG   Xenopus tropicalis (western clawed frog): 100492810Help
Entry
100492810         CDS       T01011                                 

Gene name
setd2
Definition
(RefSeq) SET domain containing 2
  KO
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100492810 (setd2)
Enzymes [BR:xtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100492810 (setd2)
Chromosome [BR:xtr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100492810 (setd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
LinkDB All DBs
Position
6
AA seq 2986 aa AA seqDB search
MGDFYDPEYPTESGIDEISAQEEKQSNPEAISLAELPACQQEEDNEAKNDASLAKGTFGK
ANPFKGLPSSRFLPKGTKAKVNLEEQGRQKVSFSFSLTKKTFQNRLLNSLGNDKQNESQS
PSPAEHISKLKLDLNDFTGETEEQTLSKPKVELGKIHFKKHLLSVTNKLPAQPPPPPPPP
ASLPAPTSPVASTQATPVKQPSSPEHEEAPAIITLGLQSTNEIPPSVVPSQAILTKEVVQ
GTCDAKESSRSLTDSKGLDKKENSVVSNLETPNNQKVSEKADLSLLKESSHIGKDEKSPC
SSQKPKLNPSPEKSSSKSKFSHSDGAVVGSESDEDSVQTSSSHKSHELKAATSKERDSKR
SSVSLRSEDSGKYSSSRSKCTKDEKYSNYSKSDRDSRYSYSHSRSDRDRRRSRSRSRSHS
RSRSDRGSKSSSSYSRSERSHYYDSDRRYHRSSPYRTRYSRSYADSRARDSSDSEDDHRR
THSRSSDSRRPSSSHSSSYRESRTSSYSKYDRDSKGDSSYDLDRRGRDTSRHERDFRRSS
EKEPSKKASPRKASPKKEAEEKREWSHSKADNSGNAGSKSGSKQEHSNSVTKPSKWDMEK
KPTQSAIEKEEHKKGKDEVLSSSNVKKTSFPAHQQTSPPYSKHSDHFTSSSPGPEFTQER
DCSSQTAKKMLHTTSGSKYDDEDDDKQHKSPFQGIYNLSPSETWDLVTLSTTEDLEPEEH
TTSSDNCRSDAYGKDSDDSQPSPHKVTKLHTRTNKISEDLQASKSTESPQKPKINELHPR
THKVSDDWQPRTHKVSDSSQHRTHKVCDDRSCKISDDLQPTTYKVSDDLQPRPHKTSDDL
ALRIHKNEDDPRTLKANEDSWTRTHKVSDNSQPRSHKESHNMQLRTHKASADTQTKTHKV
SEDSQSRSYRVSEDSQSRSHKVSEDSQSRSHKVSEDSQSRSHKVSEDLQSRSLKLSEDSQ
PRSYKVSEDSQPRSYKVSEDSQPRSHKVSEDSQPRSHKVSEDSQPRSHKVSEDSQPRSHK
VSEDSQSRSHKVSEDSQSRSHKVSEDSQSRSHKVSEDPQPKTPKKIDNQRPRTPEIIDDL
QPSTPKETDNAQPRTFKETDDLQHRLPYAAEDMQQRSANASDNTHPKIPKEGEDPKPRTS
KVNDGFQPKDHKDGNHLHSETNTIADSVDHDDSHPQTHILIDGSEPSTNEVFKINKPDTV
GVQIPIEEVDLPHDSTEIKASIPVVEHLEKSLEQCEEVEVTLAKCPSRTLETDASEMLID
KYLEHVHKPETCHSVPECQSEMASVRTDPTTEEQNEFEMGQKGTAELLKASINLNQDLPG
QVSGHLPEGISVAEETAISVAIPISENKNVVQSGNTTPFNVGADDSQGSSTPDTLGKESP
SLDEPALVDIQATERKSIYSFEGIDQPSEAVDEETKLDKEVETKSELHLENCVTEEIQRD
PTQTLNSKHEDFIGAINDFYSDSEDSESDTEDTDSDDSSLPRNRLQSVVVIPQNSTIANE
ELCRSPYESQTLSDSCETDVAESKSVSAEVVQKRVVDKECSPPAKSSDEVLEDLRAKALK
ESVSLPRRSVGVVSTSQPEVIARIRSGENHTEYKAEHETPTSTNRTGLQKENDKVELYKP
SFDQSYQHSPSNSAKKPDFFKERLHHEPPKRAGDFSRADGFQSAEDLSGLGWDFSQPEKP
SSTYQQPDSSYMYVDYNYQQAFGGAHVYRKDGDYWDPRAYEKGAQVMYSKPHGPAPDSVT
HCYDEDDEDFGWDTDHGQTYPVQSELAYNESSSVQAHEISSNSTKMVVVAPKAIPEQPAK
TSDRLDMKERGPPKKRRQELENDYENDLEALEKKHKMEAALKQDIASYLCNMDDFRDSQH
WKDCSRQGKMPPFFDLIEENVYLTERKKSKSHRDIKRMQCECPVLSKEERAQGQVACGED
CLNRLLMIECSSRCPNGDYCSNRSFQKKQHAGVEAILTEKKGWGLRAAKDLKSNTFVLEY
CGEVLDHKEFKSRVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCDPNCETQK
WTVNGQVRVGFFTTRVVPAGSELTFDYQFQRYGKEAQKCYCGAPNCRGILGGENRVSVRA
AGGKMKKERPRKKDTVDGELEALLGNGEGLSDKNQVLSLSRLMVRIETVEQKLTCLRLLK
NTQSQSYLKWFLDCHGLSVLWIWMAELGDSRGNTNNSIKLQLELIKTLEMLPIPNKNMLE
ESKILPIIQRWSQIKTAIPQLSEGDGYSSENTSRAHTPLNTPSNPTEPAAKLSVEADEET
PKKIVLRRLKIISENSMDSAVSDAASEIEVKDVPEKTEVPSVVELKDAPLPKQEETKEEL
KPEGAVPPPVKEDPAATEEQKPIIKTEGDPGVDMCKLEPLDAEKKEGNGGKLDETSAVET
PSQDEEEGVSDVESERSQEPADKILDMSDLATKLLESWKDLKEVYRIPKKTQVEKETNDR
WRDSSGSTYTTPKSQGRERDRDLERQSQRKRRQSPSPPAYYGSKRVEDSRYDTPASSKKK
SRLQDRNKLSTEERRKLFEQEVAQKEAQKQQQQMQNMGIASPMTYEAIAYGAQLPPPPFI
AYPQGYPLQSFVDPTNPNAGKVLLPTPPLDGIPSPNSFDPSQGMVVNPGMMPPQTVSVVQ
HVAAPMDVTTQQYVTQGETMVPQETNVAVLPVPAPTPVPPQNYGVWDPNQQAVTLQPPQQ
QSQPQYPPAPPQAAIYYQGQTCQPMYGVPAAYAQPPPPVVPTYTQQGLQYITGQQIYAPH
PPGVVLQQGPAVTTIVAPGQPPAMQQPEMGMAQNNVLDLPPPSPPKPKTIVLPSGWKTAR
DPEGKIYYYHVITRQTQWDPPAWDSPGEEGGALEHEAEMDLGTPTYDENPMKSSKKTKTA
EADTSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKMGRINNTEDFKHLARKLTHGVMN
KELKYCKNPEDLDCNENVKHKTKEYIKKYMQKFGTVYKPKEDIDIE
NT seq 8961 nt NT seq  +upstreamnt  +downstreamnt
atgggggatttctatgatccagaatacccaactgagtcagggattgatgagatctcagca
caggaggaaaagcagagcaatccggaggccatctcgctagcggagctccctgcttgtcaa
caggaagaagataatgaggccaaaaatgatgcttccctggctaaagggacattcggcaag
gccaatcccttcaaggggctcccctcaagccggtttttaccaaaaggaactaaagcaaag
gtgaacctggaggaacaagggcggcagaaagtctcctttagcttcagccttactaagaaa
acatttcaaaataggctgctgaattctcttggcaatgacaagcagaacgaatcgcaaagc
ccgagcccagcagaacacatctctaaacttaaactggaccttaatgatttcactggggaa
acagaggagcaaaccctctccaaacccaaagtagaactgggcaaaattcatttcaaaaaa
caccttttgagtgttactaataagctaccagcacaaccaccccctcctccacctccacca
gcctcattaccagcacccacctcacccgtggcttcaacgcaagcaacaccagtaaaacaa
ccttcttctccagagcatgaagaagcacccgcgatcattacattgggtttacagtcgaca
aatgaaatacccccttctgttgtcccctcccaggccatactcacaaaagaagtggtgcag
gggacctgtgatgcaaaggagtcgtccagatcattgactgattcaaagggactggacaaa
aaagagaactctgttgtttctaatttagaaaccccaaacaatcaaaaagtttctgagaaa
gctgatttatcattgctaaaagaatcttcccatattgggaaagatgaaaaaagtccatgt
agttcccaaaaacctaaattaaatcctagtccagaaaaatcaagttcaaaatccaagttt
tcacactccgatggggcagtggtgggctcagagtcagacgaggactctgttcaaacctcc
tcaagccacaagtcacatgagctaaaagctgctacaagcaaagaaagagactcaaaaaga
agctccgtgtctcttaggagtgaggattctgggaaatactcctcttcacgatcaaaatgt
acaaaggatgagaaatattcaaattattccaagtcagatagagattcaagatacagctac
tcacactctagatctgatcgtgaccgaaggcgaagtaggtctcgttctaggtcacactct
agatcgaggtctgacagaggctctaaaagtagctcttcttattccagatctgaacgttca
cattactatgattctgaccgtagatatcatagaagttcaccttacagaactaggtattct
cgctcctacgcagacagccgagcaagagacagctctgattctgaagatgatcataggagg
acccattccagatctagtgactctaggcgtccatcatcctctcattcctcttcatacaga
gaatctagaacttcatcatattctaaatatgacagagattcaaagggtgattcatcttat
gatttagatcggagaggaagggacaccagcagacatgaaagagacttcagaagatcttca
gaaaaagaaccatctaaaaaagcatctcctagaaaggcttcccctaaaaaagaagcagaa
gagaaacgagagtggtcacattccaaagctgataacagtgggaacgctggttccaaatcc
ggctcaaagcaggaacattcaaattctgtgactaaaccgtcaaaatgggatatggaaaag
aagccaacccaaagcgccatagagaaagaggagcacaaaaagggtaaagatgaggttcta
tcctcctcgaatgttaaaaagaccagttttccggctcaccagcaaacttcacctccatat
tctaagcactctgatcactttacctcctcctctcctggtccagagtttacacaggagaga
gactgcagtagtcaaacggctaagaaaatgttgcatactacttctggatcaaagtatgat
gatgaagatgatgataagcagcataaaagtcctttccaagggatatataatctgtctccc
agtgaaacgtgggatttggtaacactcagtaccactgaagacttggagccagaggagcac
actaccagctctgataactgtagatcagatgcgtatggtaaagattctgatgactcccag
cccagtccacataaagtcaccaagttgcacactagaaccaataagatcagtgaagatttg
caggcctctaaaagcactgagtcgccacagaaacctaaaatcaatgagttgcatccaaga
acccataaagttagtgatgattggcagcccagaacacacaaagtgagtgacagctcgcag
cacagaacccataaggtgtgtgatgaccgaagctgtaaaataagtgacgacttgcaaccc
acgacctacaaagtgagtgatgacttgcaaccaagaccccataaaacaagtgatgaccta
gcgctcagaatccataaaaatgaggatgaccctagaacccttaaagcaaatgaggattca
tggactagaacccataaggtcagtgataactcacagcccagatcccataaagagagtcac
aatatgcaactcagaacccataaagccagtgctgacacacaaactaaaacccataaagtg
agtgaggactcgcagtccaggtcctatagagtgagcgaggactcgcagtccaggtcccat
aaagtgagcgaggactcgcagtccaggtcccataaagtgagcgaggactctcagtccaga
tcccataaagtgagcgaggacttgcagtccaggtcccttaaattgagcgaggactcgcag
cccaggtcctataaagtgagcgaggactcgcagcccaggtcctataaagtgagcgaggac
tcgcagcccaggtcccataaagtgagcgaggactcgcagcccaggtcccataaagtgagc
gaggactcgcagcccaggtcccataaagtgagcgaggactcgcagcccaggtcccataaa
gtgagcgaggactctcagtccaggtcccataaagtgagcgaggactctcagtccaggtcc
cataaagtgagcgaggactctcagtccaggtcccataaagtgagcgaggacccacagccc
aaaactcctaaaaagattgacaaccagcggcccagaacccctgaaataattgatgacctc
cagcctagtactcctaaagaaactgacaatgcacagccaagaacctttaaagagactgat
gacctgcaacacagattgccttatgcagctgaagacatgcaacagagatctgctaatgca
agtgacaacacacatcccaaaatccctaaagaaggggaagacccaaaacccagaacttct
aaggtaaatgatggttttcaacccaaggaccacaaagacggcaaccatttacattctgaa
accaacaccatcgctgactctgtagaccacgatgactctcatccccaaactcacattctt
attgatggttctgaacccagcaccaatgaagtcttcaaaataaataagcctgatactgtt
ggtgtccagattccaattgaagaagtggacttgcctcatgattcaactgaaattaaagct
tctattccagtagtagaacatctagagaaatccctagaacaatgtgaagaagttgaagta
actctagccaaatgtccttctagaactttagagacagatgcctcagaaatgctcatagat
aaatatttggagcatgttcataagcccgaaacttgtcattcagtaccagaatgccaaagt
gaaatggcctcggttagaactgaccccaccacagaagagcaaaatgagtttgaaatgggc
caaaaaggaacagctgaactgctgaaggcatccatcaatttgaatcaagaccttccaggc
caagtaagtggtcacctaccagagggaatttctgtagcagaggaaacagcaatttcagtg
gcaattcccatttctgaaaataaaaatgttgttcaaagcggtaatactacaccgttcaat
gtaggtgctgatgattcacaaggtagctctacaccagacactcttggcaaagaaagtcct
tctctagatgaacctgctcttgtagacatccaggccactgaaaggaaaagtatctacagt
tttgaagggatagatcagcctagtgaagccgtagatgaggaaacaaaattggacaaggag
gtggagactaaatctgagctgcatcttgaaaactgcgttactgaggagatccaaagagac
ccaacacaaacgctcaactccaaacacgaagattttatcggtgctatcaatgatttttac
tctgactcggaagacagtgaaagtgacaccgaggacactgattcagatgacagcagtcta
cccagaaatcgtttgcagtctgtagtcgtaatcccccaaaattccaccattgcgaatgaa
gaactgtgccgttctccttatgaaagtcaaaccctctccgacagctgtgaaactgacgtc
gcagaatcaaaatcggtctcggctgaggtcgtgcagaaacgggttgtagataaagaatgc
agtcctccagctaagtcctccgatgaggttctagaagaccttcgggccaaggcgcttaag
gaatcggtgtctctgcctcgtcggagtgttggtgtcgttagcaccagccaaccagaagtt
attgcgcgtataaggagtggagagaaccacacagaatataaagcagaacatgagactcca
acatcaacgaacagaactggtctccaaaaggagaatgataaagtagaactatacaaacct
tcctttgaccagtcctaccagcactctccttcaaattctgctaagaaaccagactttttt
aaggaaagattacatcatgagcctcctaaacgggctggagatttctcaagagctgatggt
ttccagtcagcagaggacttgtctggtcttggctgggacttctcccagcctgagaaacct
agtagtacttaccagcaaccggacagtagctacatgtatgtagattataattaccagcag
gcttttggcggcgctcacgtttacaggaaagacggtgattattgggatcctagagcttat
gaaaaaggtgctcaagtgatgtacagcaaacctcatggccctgctccagactcggttaca
cattgttatgacgaagatgatgaagatttcggctgggataccgaccatggacaaacatat
ccagttcagtcagagctggcctataatgaatccagctccgtgcaggctcatgaaatcagc
agcaactccacgaagatggtggtagtagctcctaaagcaatcccggaacagccggcgaag
acgtcagacaggttggacatgaaggaacgagggccgcctaaaaagagaaggcaggaacta
gagaatgactatgaaaatgatttggaggctttggagaagaaacacaaaatggaggcagca
ttaaaacaagatattgcgagctatttgtgcaacatggacgattttcgggactctcagcac
tggaaagattgctccaggcagggtaaaatgccccccttctttgacctgatcgaggagaac
gtatacttaacagaaaggaaaaagagcaagagccacagggacatcaagaggatgcagtgc
gagtgccctgtcctctccaaagaggagagagcccagggacaggttgcttgtggagaggac
tgcctgaatcggctgctaatgatagaatgctcttcgaggtgcccaaatggagactactgc
tccaacaggagcttccaaaagaaacagcatgccggagtggaagctatccttacagagaag
aagggctgggggctccgagcagctaaagacctcaaatctaacacctttgttttggagtat
tgtggggaagtcttggaccataaggagttcaagtcgcgagtaaaggagtatgcccgcaac
aagaacatccattattattttatggctctaaagaatgatgagatcatcgatgccacacaa
aaaggcaactgctctcgttttatgaaccacagctgtgaccccaactgtgagacacagaag
tggactgtgaacggacaggtccgagttgggttttttaccacgcgtgttgtgcctgctggg
tctgagttgacgtttgactaccaattccagagatatggcaaagaggcccagaagtgctac
tgcggtgcccccaactgcaggggtattctgggaggggaaaaccgggtcagtgttagagca
gccggagggaagatgaagaaggagaggccgcgcaagaaggatacggttgacggggaactg
gaggctctgctgggaaatggggaaggtctctctgacaagaatcaagtgctcagcttatca
cggcttatggtccggattgagacggtagagcaaaaactgacctgtctccgactattaaag
aacactcagtcacagtcctacttgaaatggttccttgattgccacggcctgtctgtcctg
tggatctggatggcagagctaggagacagccgaggaaacaccaataacagcattaaattg
cagctagagctcattaaaaccttggaaatgctacctattcctaataaaaacatgctggaa
gagagcaaaattctccccatcattcagcgttggtcccagataaagacggcaatcccccag
ttgagtgaaggagacggatactcaagtgaaaatacttcccgtgcacacacgcctctcaat
actccatcaaaccccaccgaaccagcggccaagctaagtgtcgaggctgatgaagaaact
cccaaaaagattgtgctccgcaggcttaaaatcatcagcgagaacagcatggacagcgcc
gtctctgatgcagccagcgaaatagaagtgaaggacgtcccagagaaaactgaagtgcct
tctgtggttgaactgaaagatgctccattgcccaagcaggaagagactaaagaggagctt
aaaccagaaggtgcggtacctcctcctgtcaaagaggatccagcggccaccgaggaacag
aaaccaataattaaaaccgagggagacccgggggtagatatgtgcaaattggagccccta
gatgctgagaagaaggaaggcaatggaggaaagttggatgagacctctgctgtagaaacc
ccatcacaagatgaagaggaaggggtgtctgatgtggagagtgagaggagccaggagcct
gcagataagattctggatatgagtgatctggctaccaagcttctagagtcctggaaagat
ctgaaggaggtgtatcgcattcccaagaagacccaagtcgagaaggagaccaatgatcgc
tggagagactcgtctggctccacttacacgacccctaagagtcaagggcgagagcgagat
cgagatctggagagacagagccaaaggaagcgcaggcaatcgccatctccaccagcatat
tatggatcaaagcgagtggaggacagtaggtatgacaccccagcctcatccaagaagaag
agccggctacaggaccgtaacaagctgagcacggaagagcgcaggaagttgtttgaacag
gaagtggcccagaaagaggctcagaagcaacagcagcagatgcaaaacatgggcattgcc
tcccccatgacttatgaggctatagcctatggtgcacagcttcctccccctccattcatt
gcttatccccaggggtaccctctccagtcttttgtggatcccacaaatccgaatgctggc
aaggtgctattgcccactccacctctggacggtataccatctccaaacagctttgatccc
tcccaggggatggtggttaaccctgggatgatgccacctcagactgtttcagtggtgcag
catgtagcagcccctatggacgttaccacacagcagtatgtgacccagggagaaactatg
gtccctcaggaaacaaatgtggctgttcttccagtgcctgcacctacccctgtgcctcca
cagaactatggcgtttgggaccccaatcagcaggcagtgacattgcagccaccccagcaa
caatcccagcctcagtatccacctgcacccccacaggcagctatttactaccaaggtcaa
acgtgccagccaatgtatggtgtgccagcagcctatgcccagcctcccccacccgttgta
ccgacctatacacagcaaggcttgcagtacatcacaggccagcagatctacgcccctcac
ccacccggcgtggtactacagcaggggccggcagtgactaccattgtggctccgggacag
cctccagcaatgcaacagcctgagatgggaatggcgcaaaacaatgttctggaccttcct
ccaccatcaccccccaagcccaaaaccattgttcttccttctggctggaagactgcccgg
gatcctgagggcaaaatctattattaccatgtaataacaaggcaaacccagtgggaccca
cctgcctgggacagcccaggggaagaaggcggtgccttagaacatgaagcagaaatggac
ctaggaaccccaacttatgatgagaatccaatgaagtcttctaagaagaccaagacggct
gaagcagacacctcaagtgagctggcgaagaagagcaaagaagtattcagaaaggagatg
tctcagttcattgtgcagtgtctgaacccctacaggaagccggactgtaagatggggaga
ataaacaacactgaggacttcaagcatctagcacgcaagctgactcacggcgtcatgaac
aaggagctgaaatactgtaagaaccccgaggatctcgactgcaacgagaacgtcaaacac
aaaaccaaggagtacatcaagaagtatatgcagaagtttgggactgtgtataaacccaaa
gaggacatagacattgagtag

DBGET integrated database retrieval system