KEGG   Xenopus tropicalis (western clawed frog): 595089Help
Entry
595089            CDS       T01011                                 

Gene name
ptgs2, cox-2, cox2, gripghs, hcox-2, pgg/hs, pghs-2, phs-2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase)
  KO
K11987  
prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Arachidonic acid metabolism
Metabolic pathways
VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    595089 (ptgs2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    595089 (ptgs2)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     595089 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
UniProt: 
LinkDB All DBs
Position
4
AA seq 604 aa AA seqDB search
MIVLPAAVFLSLLVFSQAANPCCSNPCQNRGVCMTVGHDRYECDCTRTGFYGENCTKPEF
LSWLRLKLKPAPNTVHYILTHFKGLWNIVNNISFLRDAIMRYVLTSRSHLIDSPPTYNSH
YGYKSWEAFSNLSYYTRTLPPVERDCPTPMGVKGMKELPSAKLVVEKFLMRRKFIPDPQG
SNVMFAFFAQHFTHQFFRTDMAKGAAFTKALGHGVDLNHIYGESLERQHKLRLMKGGKLK
YQMISGEMYPPTVKTTGVDMVYPPHIPDHLQFAVGQEVFGLVPGLMMYSTIWLREHNRVC
DILSNEHPEWDDERIFQTARLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQKFQY
QNRISAEFNTLYHWHPLLPDTFAISEKEYSYPQFLYNNSVMLNHGLTEMVESFSRQTAGR
VAGGRNFPAAITRVAVASIEHSREMRYQSLNEYRKRFMLKPFESFEELTGEKEMSAELEK
LYGDIDAMEFYPGLLVEQPRPGAIFGETMVEIGAPFSLKGLMGNPICSPEYWKPSTFGGS
VGFDIVNSASLQKLICNNVRDCPYTAFHVLKSKPSEKDFINASSDSTLENVKPSLILKEH
ASEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtactacccgccgctgtgttcctctctctgctggttttctctcaagcagcaaac
ccatgctgttcaaatccctgccaaaaccggggggtatgcatgactgttggccacgaccgc
tatgaatgtgactgcacaagaacaggcttctatggagaaaactgcactaaaccggaattc
ctatcgtggttgaggctgaagctgaagccagcccccaacacagtgcactatatcctgaca
cacttcaaaggactatggaatatagtgaacaatatttccttcctgagggatgccattatg
cgatatgtcctgacatcccgatcgcacctgattgacagcccacccacgtataacagccac
tatggatataaaagctgggaggcattctccaatctgtcctattatactcgtaccttgcct
cctgtggaacgtgactgccctaccccaatgggagttaaaggaatgaaagagcttccaagt
gcaaagttggtagtggagaaattcctgatgcgaagaaaatttattcctgaccctcaaggc
tccaatgttatgtttgctttttttgctcaacacttcacacaccagttcttcagaacagat
atggccaaaggggctgccttcaccaaagcattgggccatggggttgatctcaatcatatc
tatggtgaaagcttagaaaggcaacataaactgcgtttaatgaaaggtggcaaactgaaa
tatcagatgataagtggggaaatgtacccaccaacagtgaaaaccacaggagtggatatg
gtgtacccacctcacattccagatcaccttcagtttgccgttgggcaagaggtttttggc
cttgttccagggctgatgatgtactccaccatctggttaagggagcacaatcgggtttgc
gacatactttccaacgagcatccagaatgggacgatgagcgcattttccaaactgcaaga
cttattttgattggtgaaaccatcaagattgtcatagaggactatgtacagcacctcagt
ggataccacttcaaactcaaatttgacccagagctgttgttcaaccagaaattccagtat
caaaatagaatttctgcagaattcaacaccctgtaccactggcacccccttctacccgac
acatttgccatcagtgaaaaggaatacagttacccacagtttctctacaacaattctgtc
atgttaaaccatggcctcaccgagatggttgaatctttcagcaggcaaacagctggacgg
gttgctggaggtaggaattttcctgctgctataaccagagtagctgtggcatccattgag
cacagtagagagatgagataccagtcactaaatgagtaccggaagcgtttcatgctcaaa
ccctttgagtcattcgaagagctaaccggagagaaggaaatgtcggctgaacttgagaaa
ctatacggtgatattgatgccatggaattctatcctggacttcttgtggaacagccacgc
cctggagctatctttggagagaccatggtagagataggagctccattctctctaaaaggc
ctgatgggcaaccccatttgctctcctgaatattggaaacctagtacctttggtggaagc
gtgggttttgatattgtaaattccgcctctttacaaaagctgatctgcaacaatgttaga
gactgcccttacactgcctttcatgtgctaaaaagcaagccttcagagaaggatttcatt
aatgcgagttccgactcaacactggagaatgtaaagccatctttaatactgaaagagcat
gcgtccgaactttag

DBGET integrated database retrieval system