KEGG   Yangia sp. CCB-MM3: AYJ57_18270Help
Entry
AYJ57_18270       CDS       T04443                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
yan  Yangia sp. CCB-MM3
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:yan00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AYJ57_18270
Enzymes [BR:yan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     AYJ57_18270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:complement(989228..989647)
Genome map
AA seq 139 aa AA seqDB search
MKLRQGQFSFLPDLTDDDIHAQAQYAIDNGWAVSVEYTDDPHPRNTYWEMWGHPMFDNPD
AAAVVFEVNECRKEHGGKYIRVIAFDSSAGWESIRMSFIAGRPAEEPGFRVVRQEGEGRS
IRYTIESYAVREPEGRRYA
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgagacaaggccagttcagcttcctgcccgacctgacggatgacgacatccac
gcgcaggcccaatacgccatcgacaacggctgggccgtatcggtcgaatacaccgacgac
ccgcacccacggaatacctactgggagatgtggggccacccgatgttcgacaatcccgac
gccgccgccgtggtcttcgaggtcaatgagtgccgcaaggagcatggcgggaaatacatc
cgcgtcatcgccttcgacagctccgccggatgggagtcgatccgcatgagcttcatcgcg
ggccgccccgctgaagagcccggcttccgcgtcgtgcggcaagagggcgagggccgcagc
atccgctacacgatcgagagctatgccgtgcgcgagcccgagggccgccgctacgcctag

DBGET integrated database retrieval system