KEGG   Yersinia enterocolitica FORC_002: FORC2_2180Help
Entry
FORC2_2180        CDS       T03890                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
yef  Yersinia enterocolitica FORC_002
Brite
Enzymes [BR:yef01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     FORC2_2180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AKF38327
UniProt: J7HET3
LinkDB All DBs
Position
2465449..2466027
Genome map
AA seq 192 aa AA seqDB search
MSFELPALPYAQNALEPHISAETLEYHYGKHHNTYVVNLNNLIKDTEFAGKSLEEIVKTS
SGGIFNNAAQVWNHTFYWHCLSPNGGGEPTGKVADAINQSFGSFAEFKAQFTDAAVKNFG
AGWTWLVKKADGTLAIVSTSNAATPLTTADKPLLTVDVWEHAYYIDYRNARPKYLENFWA
LVNWSFVEKNLA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgaattaccggcattaccttatgcacaaaatgcactggaaccgcacatttct
gctgaaacgctggaataccattacggcaagcaccacaacacctatgtggtaaacctcaat
aacctgatcaaggatactgagtttgcaggtaaatccttggaggagattgtcaaaacctcc
agtggcggtatttttaacaatgcagcgcaagtttggaaccacaccttttactggcactgt
ttgtcacctaatggcggtggcgaaccgacaggaaaagtcgccgatgccattaatcaatcc
tttggatcttttgctgaatttaaagcgcaatttactgatgcggcagtaaaaaactttggc
gcgggctggacctggctggtcaaaaaagcggatggcacgttagctattgtcagcacatca
aatgcggcgacaccgctgacgaccgctgataagccattgttaactgtagatgtgtgggag
cacgcttactatattgattatcgtaatgcgcgaccaaaatatctggagaatttctgggcg
ctggtgaattggtctttcgttgagaaaaacttagcctga

DBGET integrated database retrieval system