KEGG   Yersinia enterocolitica LC20: LC20_03306Help
Entry
LC20_03306        CDS       T03179                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
yel  Yersinia enterocolitica LC20
Pathway
yel00020  Citrate cycle (TCA cycle)
yel00480  Glutathione metabolism
yel01100  Metabolic pathways
yel01110  Biosynthesis of secondary metabolites
yel01120  Microbial metabolism in diverse environments
yel01130  Biosynthesis of antibiotics
yel01200  Carbon metabolism
yel01210  2-Oxocarboxylic acid metabolism
yel01230  Biosynthesis of amino acids
Module
yel_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yel_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:yel00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LC20_03306
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LC20_03306
Enzymes [BR:yel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     LC20_03306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AHM74559
UniProt: A0A2K7ZIR4
LinkDB All DBs
Position
complement(2829236..2830489)
Genome map
AA seq 417 aa AA seqDB search
MESKVVVPAEGKKITVDAQGKLVVPHNPIIPFIEGDGIGVDVTPAMINVVDAAVKKAYKG
ERKISWMEIYTGEKSTHVYGKDVWLPEETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALR
QQLDLYVCLRPVRYYEGTPSPVKHPELTNMVIFRENAEDIYAGIEWKAGSPEAEKVIKFL
REEMGVKKIRFPEQCGIGVKPCSEEGTKRLVRAAIEYAITNDRESVTLVHKGNIMKFTEG
AFKDWGYQLAREEFGGELIDGGPWVKIKNPNNGKDIIVKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILS
AEMMLRHMGWFEAADLIIKGTEGAIQAKTVTYDFERLMEGAKLLKCSEFGDAIIQHM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcagaaggtaagaaaattactgtcgatgctcagggt
aaactggttgttccgcataatccgatcattccatttattgaaggtgacggcattggcgtt
gatgtgactccagccatgattaacgtggtcgatgctgcggttaagaaagcctataaaggt
gagcgtaaaatctcctggatggaaatctacactggtgagaaatccacccatgtttatggc
aaagatgtttggctgccagaagaaacattggatctgattcgtgattaccgtgtagcaatt
aaaggcccgttgaccacgccagtgggtggcggtattcgttctctgaacgtggctttgcgc
caacaactcgacttgtatgtgtgcctgcgcccggtgcgctattacgagggtaccccaagc
ccggtaaaacaccctgaattgacgaacatggttattttccgcgaaaacgcagaagacatc
tatgcgggcattgaatggaaagccggttcaccagaagctgaaaaagtgatcaagttcctg
cgtgaagagatgggcgtgaagaaaatccgcttccctgaacaatgcggtatcggtgtaaaa
ccgtgttcagaagaagggactaagcgcttggtacgtgcggcaattgagtatgccattacc
aacgatcgtgaatcagttactctggttcataaaggcaacattatgaaattcaccgaaggc
gcatttaaagactggggttaccagttagcgcgtgaggaatttggtggtgagctgatcgac
ggcggcccatgggttaaaatcaagaatccaaacaacggtaaagacatcattgttaaggat
gttattgccgatgctttcctgcaacagattctgctgcgcccagctgagtatgatgttatt
gcctgtatgaacctgaatggcgattacatttctgatgcattggctgcgcaggttggtggt
atcggtattgccccaggtgccaacattggtgatgagtgtgcattgtttgaagccactcac
ggcacagcaccgaaatatgcgggccaagataaggtgaacccaggttctattatcttgtct
gcagaaatgatgctgcgtcacatgggttggttcgaagccgcagacctgattatcaaagga
accgaaggcgctatccaggccaagacggtcacttatgatttcgaacgactgatggaaggc
gctaagttactgaaatgtagtgaatttggcgacgccattattcaacacatgtaa

DBGET integrated database retrieval system